(data stored in SCRATCH zone)

EMBL: CP002059.PE269

CP002059.PE269       Location/Qualifiers
FT   CDS             367657..368481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0366"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /note="KEGG: npu:Npun_F4464 phosphomethylpyrimidine kinase;
FT                   TIGRFAM: phosphomethylpyrimidine kinase; PFAM:
FT                   Phosphomethylpyrimidine kinase type-1"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62937"
FT                   /db_xref="GOA:D7DZI5"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZI5"
FT                   /inference="protein motif:TFAM:TIGR00097"
FT                   /protein_id="ADI62937.1"
FT                   /translation="MIKTNAKLIPVALTIAGSDSGGGAGIQTDLRTFAFHCVHGTSAIT
FT                   CVTAQNTVGVVRVDAMSKEAVIAQIRAVVEDIGVQAAKTGMLLNEEIITAVAREVTALE
FT                   IDHLVVDPVMVSRTGAQLIDDDAVQTLCDELIPQAAIITPNRYEAQILSGLEIVSLEDM
FT                   QTAAEIIFKKLGIKAVLVKGGVMSGSLRGVDVWFDGQRLETLTTQQIETKNTHGTGCTL
FT                   SAAITANLALGKDLWTAVQQAKDYVTTALTYSLEIGKGQGPVGHFFPLLVKG"
     MIKTNAKLIP VALTIAGSDS GGGAGIQTDL RTFAFHCVHG TSAITCVTAQ NTVGVVRVDA        60
     MSKEAVIAQI RAVVEDIGVQ AAKTGMLLNE EIITAVAREV TALEIDHLVV DPVMVSRTGA       120
     QLIDDDAVQT LCDELIPQAA IITPNRYEAQ ILSGLEIVSL EDMQTAAEII FKKLGIKAVL       180
     VKGGVMSGSL RGVDVWFDGQ RLETLTTQQI ETKNTHGTGC TLSAAITANL ALGKDLWTAV       240
     QQAKDYVTTA LTYSLEIGKG QGPVGHFFPL LVKG                                   274
//

If you have problems or comments...

PBIL Back to PBIL home page