(data stored in SCRATCH zone)

EMBL: CP002059.PE276

CP002059.PE276       Location/Qualifiers
FT   CDS             complement(385417..385605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0380"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62944"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZJ2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62944.1"
FT                   /translation="MRNLALVSLAGFLVTAAAFAIPKDSVAMNAPQTLLSQKLARKNPS
FT                   PTSPPRPISTPGSPRME"
     MRNLALVSLA GFLVTAAAFA IPKDSVAMNA PQTLLSQKLA RKNPSPTSPP RPISTPGSPR        60
     ME                                                                       62
//

If you have problems or comments...

PBIL Back to PBIL home page