(data stored in SCRATCH zone)

EMBL: CP002059.PE278

CP002059.PE278       Location/Qualifiers
FT   CDS             388424..389257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0384"
FT                   /product="D12 class N6 adenine-specific DNA
FT                   methyltransferase"
FT                   /note="PFAM: D12 class N6 adenine-specific DNA
FT                   methyltransferase; KEGG: npu:Npun_R1196 D12 class N6
FT                   adenine-specific DNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62946"
FT                   /db_xref="GOA:D7DZJ4"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR012263"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR023095"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZJ4"
FT                   /inference="protein motif:PFAM:PF02086"
FT                   /protein_id="ADI62946.1"
FT                   /translation="MIKSPLGYPGGKSRAIEKISEYLPETFTHFREPFVGGGSVFIYLK
FT                   EKFPQLKIWINDLNRELFLFWHFPQSDLSKLVSEVGHIKEHHKNGRLLFSELTSVDVNT
FT                   LSDSDRAVRFFVLNRITFSGTVESGGFSLGAFHKRFTNSSIELLEKSEHILTADVKITN
FT                   LDYSQLLHGDEKNVFIFLDPPYVKAEKPKLHGKRGDLHTVFDHIRLAKSLEKCPHKWLL
FT                   TYEDALQNHEDFTWTTITEWELQYGMNNYKQTKADLSKELFISNNQVSLNEENRI"
     MIKSPLGYPG GKSRAIEKIS EYLPETFTHF REPFVGGGSV FIYLKEKFPQ LKIWINDLNR        60
     ELFLFWHFPQ SDLSKLVSEV GHIKEHHKNG RLLFSELTSV DVNTLSDSDR AVRFFVLNRI       120
     TFSGTVESGG FSLGAFHKRF TNSSIELLEK SEHILTADVK ITNLDYSQLL HGDEKNVFIF       180
     LDPPYVKAEK PKLHGKRGDL HTVFDHIRLA KSLEKCPHKW LLTYEDALQN HEDFTWTTIT       240
     EWELQYGMNN YKQTKADLSK ELFISNNQVS LNEENRI                                277
//

If you have problems or comments...

PBIL Back to PBIL home page