(data stored in SCRATCH zone)

EMBL: CP002059.PE285

CP002059.PE285       Location/Qualifiers
FT   CDS             complement(400050..400157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0396"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62953"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZK1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62953.1"
FT                   /translation="MVKAQDLSVSSIQNRSTESLKRPKFKIQNRMTAAV"
     MVKAQDLSVS SIQNRSTESL KRPKFKIQNR MTAAV                                   35
//

If you have problems or comments...

PBIL Back to PBIL home page