(data stored in SCRATCH zone)

EMBL: CP002059.PE287

CP002059.PE287       Location/Qualifiers
FT   CDS             complement(401156..402076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0398"
FT                   /product="ATP-NAD/AcoX kinase"
FT                   /note="PFAM: ATP-NAD/AcoX kinase; KEGG: ava:Ava_2718
FT                   inorganic polyphosphate/ATP-NAD kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62955"
FT                   /db_xref="GOA:D7DZK3"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZK3"
FT                   /inference="protein motif:PFAM:PF01513"
FT                   /protein_id="ADI62955.1"
FT                   /translation="MQLKQVIIAYKARDSQSKRWAELCAKQLEYHQCQVLVGPSGPKDN
FT                   PYPVFLASSSQPIDLALVLGGDGTVLTSARHLAPAGIPILGVNVGGHLGFLTESMDEFQ
FT                   DTEQVWDRLFEDRYALQRRMMLQAAVYEGDRTNLEPVTEQFLALNEFCVKPASADRMIT
FT                   SILEMEIDGEVVDQYVGDGLIVSTPTGSTGYTVSASGPIMHDGMEAITITPICPMSLSS
FT                   RPLILPPGSVVSIWPLGDYDLSTKLWMDGVLSTSIWPGHRVDVRMADCRAKFIVLRENN
FT                   SYYQTLREKLLWAGTRVRYSNNHRN"
     MQLKQVIIAY KARDSQSKRW AELCAKQLEY HQCQVLVGPS GPKDNPYPVF LASSSQPIDL        60
     ALVLGGDGTV LTSARHLAPA GIPILGVNVG GHLGFLTESM DEFQDTEQVW DRLFEDRYAL       120
     QRRMMLQAAV YEGDRTNLEP VTEQFLALNE FCVKPASADR MITSILEMEI DGEVVDQYVG       180
     DGLIVSTPTG STGYTVSASG PIMHDGMEAI TITPICPMSL SSRPLILPPG SVVSIWPLGD       240
     YDLSTKLWMD GVLSTSIWPG HRVDVRMADC RAKFIVLREN NSYYQTLREK LLWAGTRVRY       300
     SNNHRN                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page