(data stored in SCRATCH zone)

EMBL: CP002059.PE293

CP002059.PE293       Location/Qualifiers
FT   CDS             complement(405667..406803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0404"
FT                   /product="2-methylcitrate synthase/citrate synthase II"
FT                   /EC_number="2.3.3.1"
FT                   /note="TIGRFAM: 2-methylcitrate synthase/citrate synthase
FT                   II; KEGG: ava:Ava_2713 citrate synthase; PFAM: Citrate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62961"
FT                   /db_xref="GOA:D7DZK9"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR011278"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZK9"
FT                   /inference="protein motif:TFAM:TIGR01800"
FT                   /protein_id="ADI62961.1"
FT                   /translation="MTVCEYKPGLEGIPAAQSSISYVDGQKGILEYRGIRIEELAERST
FT                   FLETAYLLIWGELPNKEELAAFEDEVCTHRRIKYRIRDMMKCFPESGHPMDALQASAAA
FT                   LGLFYSRRDLHNPVYIRNAVVRLVAIIPTMVAAFQLMRKGNDPVKPRDDLDYAANFLYM
FT                   LNEKEPDPLAARIFDICLILHVEHTMNASTFSARVTASTLTDPYAVVASAVGTLGGPLH
FT                   GGANEEVIEMLEEISCVDNVRSYIEDRLQKKAKIMGFGHRVYKVKDPRATILQRLAEQL
FT                   FDKFGYDKYYEVAQEVEWVMAEKVGSKGIYPNVDFYSGLVYRKMGIPTDLFTPVFAIAR
FT                   VAGWLAHWKEQLAENRIFRPTQVYNGRHEITYTPIDKR"
     MTVCEYKPGL EGIPAAQSSI SYVDGQKGIL EYRGIRIEEL AERSTFLETA YLLIWGELPN        60
     KEELAAFEDE VCTHRRIKYR IRDMMKCFPE SGHPMDALQA SAAALGLFYS RRDLHNPVYI       120
     RNAVVRLVAI IPTMVAAFQL MRKGNDPVKP RDDLDYAANF LYMLNEKEPD PLAARIFDIC       180
     LILHVEHTMN ASTFSARVTA STLTDPYAVV ASAVGTLGGP LHGGANEEVI EMLEEISCVD       240
     NVRSYIEDRL QKKAKIMGFG HRVYKVKDPR ATILQRLAEQ LFDKFGYDKY YEVAQEVEWV       300
     MAEKVGSKGI YPNVDFYSGL VYRKMGIPTD LFTPVFAIAR VAGWLAHWKE QLAENRIFRP       360
     TQVYNGRHEI TYTPIDKR                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page