(data stored in SCRATCH zone)

EMBL: CP002059.PE309

CP002059.PE309       Location/Qualifiers
FT   CDS             436551..437459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0426"
FT                   /product="protein of unknown function DUF422"
FT                   /note="PFAM: protein of unknown function DUF422; KEGG:
FT                   ana:all0144 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62977"
FT                   /db_xref="GOA:D7E068"
FT                   /db_xref="InterPro:IPR007354"
FT                   /db_xref="UniProtKB/TrEMBL:D7E068"
FT                   /inference="protein motif:PFAM:PF04240"
FT                   /protein_id="ADI62977.1"
FT                   /translation="MKQLVIVERVCLIGHIVSMVFGLVGILLVIPNAELILSLSEVGQT
FT                   VMQWSMAGGGVAYMILGAVGVFLYAYRTLGLGRALCFLLPSVLISLTSELLGTSTGFPF
FT                   GNYSYLSGLGYKIAGLVPFTIPLSWFYVGCVSYLLARVGLEVDKKPSLFRHLGAIALGA
FT                   LLLTSWDFVLDPAMSQTSLPFWYWQQPGAFFGMPYQNFAGWMGTGSVFMTVAAVLWRNN
FT                   PVKLERAQLNIPLVVYLGNFGFATVMSLAAGFSIPVLLGLVLGVAPAVALWLRGPGAST
FT                   LVGVEPATKEVSVASVKVAFK"
     MKQLVIVERV CLIGHIVSMV FGLVGILLVI PNAELILSLS EVGQTVMQWS MAGGGVAYMI        60
     LGAVGVFLYA YRTLGLGRAL CFLLPSVLIS LTSELLGTST GFPFGNYSYL SGLGYKIAGL       120
     VPFTIPLSWF YVGCVSYLLA RVGLEVDKKP SLFRHLGAIA LGALLLTSWD FVLDPAMSQT       180
     SLPFWYWQQP GAFFGMPYQN FAGWMGTGSV FMTVAAVLWR NNPVKLERAQ LNIPLVVYLG       240
     NFGFATVMSL AAGFSIPVLL GLVLGVAPAV ALWLRGPGAS TLVGVEPATK EVSVASVKVA       300
     FK                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page