(data stored in SCRATCH zone)

EMBL: CP002059.PE314

CP002059.PE314       Location/Qualifiers
FT   CDS             complement(442401..442517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0432"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpt:Mpe_A0746 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62982"
FT                   /db_xref="UniProtKB/TrEMBL:D7E073"
FT                   /inference="similar to AA sequence:KEGG:Mpe_A0746"
FT                   /protein_id="ADI62982.1"
FT                   /translation="MKYVLIIHEVEDYDSWKKVFDNAGDIRKQAGEIVYHDF"
     MKYVLIIHEV EDYDSWKKVF DNAGDIRKQA GEIVYHDF                                38
//

If you have problems or comments...

PBIL Back to PBIL home page