(data stored in SCRATCH zone)

EMBL: CP002059.PE371

CP002059.PE371       Location/Qualifiers
FT   CDS             complement(545667..546302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0527"
FT                   /product="2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase"
FT                   /note="KEGG: npu:Npun_F2718
FT                   2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase; TIGRFAM:
FT                   2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase; PFAM: KDPG and
FT                   KHG aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63039"
FT                   /db_xref="GOA:D7E0D0"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0D0"
FT                   /inference="protein motif:TFAM:TIGR01182"
FT                   /protein_id="ADI63039.1"
FT                   /translation="MSNQVWLSQLQQNRAIAVIRAPKMVWGEKMAVAVADGGMHLIEIT
FT                   WNSDRAADLISQLRTHLPHCLIGTGTLFNVQQLQDAIAAGAQFLFTPHTDPEMIKVAVS
FT                   QDVPIIPGALTPTEIATAWTQGASCVKVFPVQAVGGSNYIQSLQAPLGHIPLIPTGGVT
FT                   LENAQDFLQVGAVAVGLSGKLFPKKWVLEENWSAIGLQAKNLMGTLNS"
     MSNQVWLSQL QQNRAIAVIR APKMVWGEKM AVAVADGGMH LIEITWNSDR AADLISQLRT        60
     HLPHCLIGTG TLFNVQQLQD AIAAGAQFLF TPHTDPEMIK VAVSQDVPII PGALTPTEIA       120
     TAWTQGASCV KVFPVQAVGG SNYIQSLQAP LGHIPLIPTG GVTLENAQDF LQVGAVAVGL       180
     SGKLFPKKWV LEENWSAIGL QAKNLMGTLN S                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page