(data stored in SCRATCH zone)

EMBL: CP002059.PE373

CP002059.PE373       Location/Qualifiers
FT   CDS             553274..554845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0532"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /note="KEGG: ava:Ava_4463 apolipoprotein N-acyltransferase;
FT                   TIGRFAM: apolipoprotein N-acyltransferase; PFAM:
FT                   Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63041"
FT                   /db_xref="GOA:D7E0D2"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0D2"
FT                   /inference="protein motif:TFAM:TIGR00546"
FT                   /protein_id="ADI63041.1"
FT                   /translation="MKYLETKLFSSFHLYGLSFISGILMGVTVAPIGAWFFAWFALAPF
FT                   WVLVVKYTTRIKTAAFLWALAYHGIAVSWIMGIHPMNWLGVPWWPSLAITIFCWTFISL
FT                   WGGILVSLWAILMVRLDKQKPWLRVLIGTALWCALESLWSSGSLWWSSLSYTQSPHNLV
FT                   ILHLGKLSGPNTVTAVIVAVNGLLGEACIYYENSTQKRKSAKEEKGLGKGLVNGYLILA
FT                   FSLFILSHLIGFILYTQPLKPTQTTALKIGIIQGNIPNQIKLRPEGLRRAVTGYTNGYL
FT                   KLANQGVNGVLTPEGALPLYERNFKSTPLLDAVKEKGVIAWIGGFGERGKSYTNSLFGV
FT                   NSKGEITSRYDKSKLVPLGEYIPFEQILRAVIQRLSPLDEHQVHGAANQVFHTPFGRVI
FT                   VGICYESAFSETFRRQAFKGGQFILISSNDAHYTAAMADQHHAQDIMRAVETDRWAVRA
FT                   TNTGYSGFVDPHGRTVWKSAYNTYETHAETIYPRQTQTLYVRFGDWLMPLLLILGILAW
FT                   FIKPVG"
     MKYLETKLFS SFHLYGLSFI SGILMGVTVA PIGAWFFAWF ALAPFWVLVV KYTTRIKTAA        60
     FLWALAYHGI AVSWIMGIHP MNWLGVPWWP SLAITIFCWT FISLWGGILV SLWAILMVRL       120
     DKQKPWLRVL IGTALWCALE SLWSSGSLWW SSLSYTQSPH NLVILHLGKL SGPNTVTAVI       180
     VAVNGLLGEA CIYYENSTQK RKSAKEEKGL GKGLVNGYLI LAFSLFILSH LIGFILYTQP       240
     LKPTQTTALK IGIIQGNIPN QIKLRPEGLR RAVTGYTNGY LKLANQGVNG VLTPEGALPL       300
     YERNFKSTPL LDAVKEKGVI AWIGGFGERG KSYTNSLFGV NSKGEITSRY DKSKLVPLGE       360
     YIPFEQILRA VIQRLSPLDE HQVHGAANQV FHTPFGRVIV GICYESAFSE TFRRQAFKGG       420
     QFILISSNDA HYTAAMADQH HAQDIMRAVE TDRWAVRATN TGYSGFVDPH GRTVWKSAYN       480
     TYETHAETIY PRQTQTLYVR FGDWLMPLLL ILGILAWFIK PVG                         523
//

If you have problems or comments...

PBIL Back to PBIL home page