(data stored in SCRATCH zone)

EMBL: CP002059.PE375

CP002059.PE375       Location/Qualifiers
FT   CDS             555341..556255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0534"
FT                   /product="Histone deacetylase"
FT                   /note="KEGG: ava:Ava_4443 histone deacetylase superfamily
FT                   protein; PFAM: histone deacetylase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63043"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0D4"
FT                   /inference="protein motif:PRIAM:3.5.1.98"
FT                   /protein_id="ADI63043.1"
FT                   /translation="MLPVIYSDEFLDHITGPYHPEKPERLRAIVNALKTANFAEKIEWV
FT                   NPQPVKPELMSWIEIAHHQTYIKKVKDIASSGGGYLDGDTPISPRSYDVALLAVSAWLD
FT                   GVNEVLTRENPAFVLARPPGHHAESDTGMGFCLFSNAAIAALYALQQAGVNRVAILDWD
FT                   VHHGNGTQAIVETHSQIAYCSLHQYPAYPGTGKASEKGLHNNVLNLPLPPGSDITTYQP
FT                   LWESLILPFLTKFQPDLLIVSAGYDALEDDGLASVNLQPEDFGLFTEHSLGITRKILFG
FT                   LEGGYDLQTLSKSVVATIESCCI"
     MLPVIYSDEF LDHITGPYHP EKPERLRAIV NALKTANFAE KIEWVNPQPV KPELMSWIEI        60
     AHHQTYIKKV KDIASSGGGY LDGDTPISPR SYDVALLAVS AWLDGVNEVL TRENPAFVLA       120
     RPPGHHAESD TGMGFCLFSN AAIAALYALQ QAGVNRVAIL DWDVHHGNGT QAIVETHSQI       180
     AYCSLHQYPA YPGTGKASEK GLHNNVLNLP LPPGSDITTY QPLWESLILP FLTKFQPDLL       240
     IVSAGYDALE DDGLASVNLQ PEDFGLFTEH SLGITRKILF GLEGGYDLQT LSKSVVATIE       300
     SCCI                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page