(data stored in SCRATCH zone)

EMBL: CP002059.PE377

CP002059.PE377       Location/Qualifiers
FT   CDS             557734..559098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0537"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate/D-alanyl-D-alanyl ligase"
FT                   /note="KEGG: npu:Npun_F4185
FT                   UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate--D-alanyl- D-alanyl ligase; TIGRFAM:
FT                   UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate/D-alanyl-D-alanyl ligase; PFAM: Mur
FT                   ligase middle domain protein; cytoplasmic peptidoglycan
FT                   synthetase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63045"
FT                   /db_xref="GOA:D7E0D6"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0D6"
FT                   /inference="protein motif:TFAM:TIGR01143"
FT                   /protein_id="ADI63045.1"
FT                   /translation="MPVSATLSQLVEILSASSVNLSASALTKVSKSIQTDTRILQPGEV
FT                   FVALRGEKFDGHEFVAMAIVKGAIAAIVDYAYENPVFPVLQVTDTLKAYQQIGRWWRDS
FT                   YSIPVIGVTGSVGKTTTKELIAAVLATKGQVHKTYGNFNNEIGVPKTLLELGAEHDFAV
FT                   IEMAMRGRGQIAELTQIARPTIGVITNVGTAHIELLSSEEAIAEAKCELLAEMPNDSVA
FT                   ILNYDSPLLMETAKKFWQGKVISYGFSGGDIQGKLIDNETVEVAGIGLPLPLPGRHNAT
FT                   NFLAALAVAKVLEIDWQSLQAGVIVNMPNGRSQRFTLPNDVIILDETYNAAPEAMLAAL
FT                   QLLADIPGKRKIAVLGVMKELGERSQQLHQQVGEMVQKLNLDGLLLLVDSKDAEFIANS
FT                   AKGIPCECFATHADLIARLKTFMQAGDRLLFKAAHSVGLDRVVNQLRLELIISNQ"
     MPVSATLSQL VEILSASSVN LSASALTKVS KSIQTDTRIL QPGEVFVALR GEKFDGHEFV        60
     AMAIVKGAIA AIVDYAYENP VFPVLQVTDT LKAYQQIGRW WRDSYSIPVI GVTGSVGKTT       120
     TKELIAAVLA TKGQVHKTYG NFNNEIGVPK TLLELGAEHD FAVIEMAMRG RGQIAELTQI       180
     ARPTIGVITN VGTAHIELLS SEEAIAEAKC ELLAEMPNDS VAILNYDSPL LMETAKKFWQ       240
     GKVISYGFSG GDIQGKLIDN ETVEVAGIGL PLPLPGRHNA TNFLAALAVA KVLEIDWQSL       300
     QAGVIVNMPN GRSQRFTLPN DVIILDETYN AAPEAMLAAL QLLADIPGKR KIAVLGVMKE       360
     LGERSQQLHQ QVGEMVQKLN LDGLLLLVDS KDAEFIANSA KGIPCECFAT HADLIARLKT       420
     FMQAGDRLLF KAAHSVGLDR VVNQLRLELI ISNQ                                   454
//

If you have problems or comments...

PBIL Back to PBIL home page