(data stored in SCRATCH zone)

EMBL: CP002059.PE38

CP002059.PE38        Location/Qualifiers
FT   CDS             complement(47506..47799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0052"
FT                   /product="protein of unknown function YGGT"
FT                   /note="PFAM: protein of unknown function YGGT; KEGG:
FT                   npu:Npun_F5950 protein of unknown function YGGT"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62706"
FT                   /db_xref="GOA:D7DVD1"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVD1"
FT                   /inference="protein motif:PFAM:PF02325"
FT                   /protein_id="ADI62706.1"
FT                   /translation="MTGINLTVWILSPVLGIMTFLFIFRIILTWYPQVNLNRLPFNLIA
FT                   WPTEPFLVLLRKVVQPIGGVDITPIIWVGIFSFIREILLGQQGLLTMMACVN"
     MTGINLTVWI LSPVLGIMTF LFIFRIILTW YPQVNLNRLP FNLIAWPTEP FLVLLRKVVQ        60
     PIGGVDITPI IWVGIFSFIR EILLGQQGLL TMMACVN                                 97
//

If you have problems or comments...

PBIL Back to PBIL home page