(data stored in SCRATCH zone)

EMBL: CP002059.PE381

CP002059.PE381       Location/Qualifiers
FT   CDS             complement(568531..570762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0546"
FT                   /product="photosystem I core protein PsaB"
FT                   /note="KEGG: ana:alr5155 photosystem I P700 chlorophyll a
FT                   apoprotein A2; TIGRFAM: photosystem I core protein PsaB;
FT                   PFAM: photosystem I psaA and psaB"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63049"
FT                   /db_xref="GOA:D7E0E0"
FT                   /db_xref="InterPro:IPR001280"
FT                   /db_xref="InterPro:IPR006244"
FT                   /db_xref="InterPro:IPR020586"
FT                   /db_xref="InterPro:IPR036408"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0E0"
FT                   /inference="protein motif:TFAM:TIGR01336"
FT                   /protein_id="ADI63049.1"
FT                   /translation="MATKFPKFSQDLAQDPTTRRIWYAIATGNDFESHDGMTEENLYQK
FT                   IFATHFGHLAIIFLWASSLLFHVAWQGNFEQWIKDPLHVRPIAHAIWDPHFGAPAVEAF
FT                   TQAGASNPVNIAYSGVYHWWYTIGMRTNQELYTGSVGLLLLAALFLFAGWLHLQPKFRP
FT                   SLSWFKSAEPRLNHHLGGLFGVSSLAWTGHLVHVAIPESRGIHVGWDNFLTAAPHPAGL
FT                   TPFFTGNWGVYAQNPDTAGHLFGTSTGAGTAILTFLGGFHPQTESLWLTDMAHHHLAIA
FT                   VLFIIAGHMYRTNFGIGHSIKEMLNSKSGLVPGSKSEGQFNLPHQGLYDTINNSLHFQL
FT                   SLALAALGTITSLVAQHMYSLPPYAFIAKDYTTQAALYTHHQYIAGFLMVGAFAHAAIF
FT                   WVRDYDPEQNKGNVLDRILQHKEAIISHLSWVSLFLGFHTLGLYVHNDVVVAFGTPEKQ
FT                   ILIEPVFAQFIQAAHGKLLYGLDTLLSNPDSVAYTAYPNYGNVWLSGWLDAINSGTNSL
FT                   FLTIGPGDFLVHHAFALAIHTTTLVLVKGALDARGSKLMPDKKDFGYAFPCDGPGRGGT
FT                   CDISAWDAFYLSMFWMLNTIGWVTFYWHWKHLGIWQGNVAQFNENSTYLMGWFRDYLWA
FT                   NSAQLINGYNAYGMNNLSVWTWMFLFGHLIWATGFMFLISWRGYWQELIETLVWAHERT
FT                   PLANLVRWKDKPVALSIVQARVVGLAHFTVGYIVTYAAFLIASTAGKFG"
     MATKFPKFSQ DLAQDPTTRR IWYAIATGND FESHDGMTEE NLYQKIFATH FGHLAIIFLW        60
     ASSLLFHVAW QGNFEQWIKD PLHVRPIAHA IWDPHFGAPA VEAFTQAGAS NPVNIAYSGV       120
     YHWWYTIGMR TNQELYTGSV GLLLLAALFL FAGWLHLQPK FRPSLSWFKS AEPRLNHHLG       180
     GLFGVSSLAW TGHLVHVAIP ESRGIHVGWD NFLTAAPHPA GLTPFFTGNW GVYAQNPDTA       240
     GHLFGTSTGA GTAILTFLGG FHPQTESLWL TDMAHHHLAI AVLFIIAGHM YRTNFGIGHS       300
     IKEMLNSKSG LVPGSKSEGQ FNLPHQGLYD TINNSLHFQL SLALAALGTI TSLVAQHMYS       360
     LPPYAFIAKD YTTQAALYTH HQYIAGFLMV GAFAHAAIFW VRDYDPEQNK GNVLDRILQH       420
     KEAIISHLSW VSLFLGFHTL GLYVHNDVVV AFGTPEKQIL IEPVFAQFIQ AAHGKLLYGL       480
     DTLLSNPDSV AYTAYPNYGN VWLSGWLDAI NSGTNSLFLT IGPGDFLVHH AFALAIHTTT       540
     LVLVKGALDA RGSKLMPDKK DFGYAFPCDG PGRGGTCDIS AWDAFYLSMF WMLNTIGWVT       600
     FYWHWKHLGI WQGNVAQFNE NSTYLMGWFR DYLWANSAQL INGYNAYGMN NLSVWTWMFL       660
     FGHLIWATGF MFLISWRGYW QELIETLVWA HERTPLANLV RWKDKPVALS IVQARVVGLA       720
     HFTVGYIVTY AAFLIASTAG KFG                                               743
//

If you have problems or comments...

PBIL Back to PBIL home page