(data stored in SCRATCH zone)

EMBL: CP002059.PE386

CP002059.PE386       Location/Qualifiers
FT   CDS             578383..578571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0554"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: npu:Npun_F2488 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63054"
FT                   /db_xref="InterPro:IPR025148"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0E5"
FT                   /inference="similar to AA sequence:KEGG:Npun_F2488"
FT                   /protein_id="ADI63054.1"
FT                   /translation="MNNQEIDIDEYIEQISLLLNLEIKDEYRNEMIADFEKLISIAKIV
FT                   NNCPLPEEIEIAPVFEP"
     MNNQEIDIDE YIEQISLLLN LEIKDEYRNE MIADFEKLIS IAKIVNNCPL PEEIEIAPVF        60
     EP                                                                       62
//

If you have problems or comments...

PBIL Back to PBIL home page