(data stored in SCRATCH zone)

EMBL: CP002059.PE392

CP002059.PE392       Location/Qualifiers
FT   CDS             complement(591022..591477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0564"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; KEGG: npu:Npun_F0997
FT                   ferric uptake regulator family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63060"
FT                   /db_xref="GOA:D7E0F1"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0F1"
FT                   /inference="protein motif:PFAM:PF01475"
FT                   /protein_id="ADI63060.1"
FT                   /translation="MTVYTTGSLKAELNDRGWRLTPQRETILHIFQELPQGEHLSAEDL
FT                   YLRLESDGEGISLSTIYRTLKLMARMGILRELELGEGHKHYEINQPYPHHHHHLICVRC
FT                   NTTIEFKNESILKIGVKTAQKEGFHLLDCQLTIHAVCPKCQRALMPV"
     MTVYTTGSLK AELNDRGWRL TPQRETILHI FQELPQGEHL SAEDLYLRLE SDGEGISLST        60
     IYRTLKLMAR MGILRELELG EGHKHYEINQ PYPHHHHHLI CVRCNTTIEF KNESILKIGV       120
     KTAQKEGFHL LDCQLTIHAV CPKCQRALMP V                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page