(data stored in SCRATCH zone)

EMBL: CP002059.PE393

CP002059.PE393       Location/Qualifiers
FT   CDS             complement(591624..592877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0565"
FT                   /product="RNA polymerase, sigma 70 subunit, RpoD subfamily"
FT                   /note="KEGG: ava:Ava_1164 RNA polymerase sigma factor SigC;
FT                   TIGRFAM: RNA polymerase sigma factor; RNA polymerase sigma
FT                   factor, sigma-70 family; PFAM: sigma-70 region 3 domain
FT                   protein; sigma-70 region 2 domain protein; sigma-70 region
FT                   4 domain protein; sigma-70 region 1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63061"
FT                   /db_xref="GOA:D7E0F2"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR017848"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0F2"
FT                   /inference="protein motif:TFAM:TIGR02997"
FT                   /protein_id="ADI63061.1"
FT                   /translation="MPATSFHTDTAYDSPRSNPKLEPDLGIDDGDFSLDDLQDLDIAAA
FT                   VDSHNLAANTNRRSTDLVRLYLQEIGRVRLLGRDEEVSEAQKVQRYLRLRIVLANAAKQ
FT                   GDTVIVPYQRLIEVQERLSSELGHRPSLERWAKTAGIDLADLKPTLLEGKRRWAEIAKL
FT                   KVEELENVQSQGLQAKEHMIKANLRLVVSVAKKYQNRGLELLDLVQEGTLGLERAVEKF
FT                   DPTKGYRFSTYAYWWIRQGITRAIATSSRTIRLPVHITEKLNKIKKAQRKISQEKGRTP
FT                   TLEDLAIELDMTPTQVREVLLRVPRSVSLETKVGKDKDTELGELLETDSITPEEMLMRE
FT                   SLQKDLHHLLADLTSRERDVILMRFGLSDGHPYSLAEIGRALDLSRERVRQIESKALQK
FT                   LRQPKRRNLIRDYLESLS"
     MPATSFHTDT AYDSPRSNPK LEPDLGIDDG DFSLDDLQDL DIAAAVDSHN LAANTNRRST        60
     DLVRLYLQEI GRVRLLGRDE EVSEAQKVQR YLRLRIVLAN AAKQGDTVIV PYQRLIEVQE       120
     RLSSELGHRP SLERWAKTAG IDLADLKPTL LEGKRRWAEI AKLKVEELEN VQSQGLQAKE       180
     HMIKANLRLV VSVAKKYQNR GLELLDLVQE GTLGLERAVE KFDPTKGYRF STYAYWWIRQ       240
     GITRAIATSS RTIRLPVHIT EKLNKIKKAQ RKISQEKGRT PTLEDLAIEL DMTPTQVREV       300
     LLRVPRSVSL ETKVGKDKDT ELGELLETDS ITPEEMLMRE SLQKDLHHLL ADLTSRERDV       360
     ILMRFGLSDG HPYSLAEIGR ALDLSRERVR QIESKALQKL RQPKRRNLIR DYLESLS          417
//

If you have problems or comments...

PBIL Back to PBIL home page