(data stored in SCRATCH zone)

EMBL: CP002059.PE395

CP002059.PE395       Location/Qualifiers
FT   CDS             complement(594646..595515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0567"
FT                   /product="lipoic acid synthetase"
FT                   /EC_number="2.8.1.8"
FT                   /note="SMART: Elongator protein 3/MiaB/NifB; TIGRFAM:
FT                   lipoic acid synthetase; KEGG: npu:Npun_F0994 lipoic acid
FT                   synthetase; PFAM: Radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63063"
FT                   /db_xref="GOA:D7E0F4"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0F4"
FT                   /inference="protein motif:TFAM:TIGR00510"
FT                   /protein_id="ADI63063.1"
FT                   /translation="MTLKPDWLRVKAPHWERVGNVKEILRDLSLNTVCEEASCPNIGEC
FT                   FNAGTATFLIMGPACTRACPYCDIDFEKKPQPLDSTEPTRLAEAVRRMWLNHVVITSVN
FT                   RDDLPDGGASQFVHCINAVRSVSPHTTIEVLIPDLCGNWNALEIILEAAPEVLNHNTET
FT                   ISRLYWRVRPQGNYERTMELLQRSRQISPSTYTKSGIMVGLGETDAEIRQVMQDLRAVD
FT                   CDILTIGQYLQPSQKHLQVAEFISREQFAAWKVFGEKLGFLQIISSPLTRSSYHAEQVR
FT                   ELITRHPR"
     MTLKPDWLRV KAPHWERVGN VKEILRDLSL NTVCEEASCP NIGECFNAGT ATFLIMGPAC        60
     TRACPYCDID FEKKPQPLDS TEPTRLAEAV RRMWLNHVVI TSVNRDDLPD GGASQFVHCI       120
     NAVRSVSPHT TIEVLIPDLC GNWNALEIIL EAAPEVLNHN TETISRLYWR VRPQGNYERT       180
     MELLQRSRQI SPSTYTKSGI MVGLGETDAE IRQVMQDLRA VDCDILTIGQ YLQPSQKHLQ       240
     VAEFISREQF AAWKVFGEKL GFLQIISSPL TRSSYHAEQV RELITRHPR                   289
//

If you have problems or comments...

PBIL Back to PBIL home page