(data stored in SCRATCH zone)

EMBL: CP002059.PE398

CP002059.PE398       Location/Qualifiers
FT   CDS             596912..597466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0570"
FT                   /product="Ferritin Dps family protein"
FT                   /note="PFAM: Ferritin Dps family protein; KEGG:
FT                   ava:Ava_1894 ferritin and Dps"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63066"
FT                   /db_xref="GOA:D7E0F7"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR023188"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0F7"
FT                   /inference="protein motif:PFAM:PF00210"
FT                   /protein_id="ADI63066.1"
FT                   /translation="MSDTQAILHNFGQVYDNPILLDNSVTAPVVEGFNVTLASFQALYL
FT                   QYQKHHFVVEGAEFTSLHDFFNDSYREVQDHIHEIGERLNGLGGVPAASFSKLAELCCF
FT                   EPEADGVYSSQKMVENDLAAEQVMIGVIRRQATQAESLGDRGTRYLYEKILLKTEERAY
FT                   HLAHLLAKESLTLGFLQPAHK"
     MSDTQAILHN FGQVYDNPIL LDNSVTAPVV EGFNVTLASF QALYLQYQKH HFVVEGAEFT        60
     SLHDFFNDSY REVQDHIHEI GERLNGLGGV PAASFSKLAE LCCFEPEADG VYSSQKMVEN       120
     DLAAEQVMIG VIRRQATQAE SLGDRGTRYL YEKILLKTEE RAYHLAHLLA KESLTLGFLQ       180
     PAHK                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page