(data stored in SCRATCH zone)

EMBL: CP002059.PE41

CP002059.PE41        Location/Qualifiers
FT   CDS             48374..49294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0055"
FT                   /product="Ycf66 family protein"
FT                   /note="PFAM: Ycf66 family protein; KEGG: npu:Npun_R5948
FT                   Ycf66 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62709"
FT                   /db_xref="GOA:D7DVD4"
FT                   /db_xref="InterPro:IPR010004"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVD4"
FT                   /inference="protein motif:PFAM:PF07444"
FT                   /protein_id="ADI62709.1"
FT                   /translation="MINFGLNSASVLAQVNFGANSASILGIFLAVAGAALYFLRTVRPE
FT                   LSRDQDIFFAAVGLLCGFILIFQGWRLDPILQFGQLLLVGSTVFFAVESIRLRSIATQQ
FT                   AKRNTPIVDDEREVSRKYSYSDRRNYQAEMDADLEPLPYYEEEEEDRPVRAKIRGSKDE
FT                   RSGREDYYEDQAPRRLERRNTREKPETTEKKRRTSSYSRSVNRPSESYEQENWGSVSRE
FT                   VDDWESSQEEVRKTPRRTTSNRPQRPASSEDDVAPRPRKGRPPVDSSPPRERYDEAIPT
FT                   DYVPYNPIEKPNDGSDNANDFDDEI"
     MINFGLNSAS VLAQVNFGAN SASILGIFLA VAGAALYFLR TVRPELSRDQ DIFFAAVGLL        60
     CGFILIFQGW RLDPILQFGQ LLLVGSTVFF AVESIRLRSI ATQQAKRNTP IVDDEREVSR       120
     KYSYSDRRNY QAEMDADLEP LPYYEEEEED RPVRAKIRGS KDERSGREDY YEDQAPRRLE       180
     RRNTREKPET TEKKRRTSSY SRSVNRPSES YEQENWGSVS REVDDWESSQ EEVRKTPRRT       240
     TSNRPQRPAS SEDDVAPRPR KGRPPVDSSP PRERYDEAIP TDYVPYNPIE KPNDGSDNAN       300
     DFDDEI                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page