(data stored in SCRATCH zone)

EMBL: CP002059.PE410

CP002059.PE410       Location/Qualifiers
FT   CDS             610393..611049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0583"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="KEGG: cyh:Cyan8802_4630 transposase, IS605 OrfB
FT                   family; TIGRFAM: transposase, IS605 OrfB family; PFAM:
FT                   transposase IS605 OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63078"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0U9"
FT                   /inference="protein motif:TFAM:TIGR01766"
FT                   /protein_id="ADI63078.1"
FT                   /translation="MDAPPIKSINQWFNKRNAQLQYIKDTLLIKGITNQQVKLTAKRNN
FT                   QVRDYLNKTGRFMVNHCIQNSIANLIVGYNPSIKQEINIGGCNNQNFVQIPFHTLPYKL
FT                   KAMCERYGLNYQEQDESYTSKASAPDGDEIPVYNAENPKEYQFSDKRIQRGFYRTKTAH
FT                   LVNADLNGSLNIGRKSKHEGFNRVSRGSLTAPRRINLLKLERKTPSKQYGFSLVV"
     MDAPPIKSIN QWFNKRNAQL QYIKDTLLIK GITNQQVKLT AKRNNQVRDY LNKTGRFMVN        60
     HCIQNSIANL IVGYNPSIKQ EINIGGCNNQ NFVQIPFHTL PYKLKAMCER YGLNYQEQDE       120
     SYTSKASAPD GDEIPVYNAE NPKEYQFSDK RIQRGFYRTK TAHLVNADLN GSLNIGRKSK       180
     HEGFNRVSRG SLTAPRRINL LKLERKTPSK QYGFSLVV                               218
//

If you have problems or comments...

PBIL Back to PBIL home page