(data stored in SCRATCH zone)

EMBL: CP002059.PE416

CP002059.PE416       Location/Qualifiers
FT   CDS             624489..624950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0596"
FT                   /product="protein of unknown function DUF150"
FT                   /note="PFAM: protein of unknown function DUF150; KEGG:
FT                   npu:Npun_R5776 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63084"
FT                   /db_xref="GOA:D7E0V5"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0V5"
FT                   /inference="protein motif:PFAM:PF02576"
FT                   /protein_id="ADI63084.1"
FT                   /translation="MTHPLVPQIIDLAIPVAEQLGLEVVGIVLHTNQRPPVLRVDIRNT
FT                   QQDTSLDDCERMSRVLEASLDAAEIIPDAYVLEVSSPGISRQLITDREFISFKGFPVVI
FT                   STSQPYDGQQEWTGQLIRRGETKIYLNQKGRVVEIPRPLVTRVQLDERR"
     MTHPLVPQII DLAIPVAEQL GLEVVGIVLH TNQRPPVLRV DIRNTQQDTS LDDCERMSRV        60
     LEASLDAAEI IPDAYVLEVS SPGISRQLIT DREFISFKGF PVVISTSQPY DGQQEWTGQL       120
     IRRGETKIYL NQKGRVVEIP RPLVTRVQLD ERR                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page