(data stored in SCRATCH zone)

EMBL: CP002059.PE418

CP002059.PE418       Location/Qualifiers
FT   CDS             626498..626770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0598"
FT                   /product="protein of unknown function DUF448"
FT                   /note="PFAM: protein of unknown function DUF448; KEGG:
FT                   npu:Npun_R5774 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63086"
FT                   /db_xref="InterPro:IPR007393"
FT                   /db_xref="InterPro:IPR035931"
FT                   /db_xref="InterPro:IPR037465"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0V7"
FT                   /inference="protein motif:PFAM:PF04296"
FT                   /protein_id="ADI63086.1"
FT                   /translation="MKPNYRRCISCRRLGLREEFWRIVRLFPSGKVQLDEGMGRSAYIC
FT                   PQTSCLQAAQKKNRLGRSLHGAVPETVYQTLWQRLTVSNTQENQI"
     MKPNYRRCIS CRRLGLREEF WRIVRLFPSG KVQLDEGMGR SAYICPQTSC LQAAQKKNRL        60
     GRSLHGAVPE TVYQTLWQRL TVSNTQENQI                                         90
//

If you have problems or comments...

PBIL Back to PBIL home page