(data stored in SCRATCH zone)

EMBL: CP002059.PE432

CP002059.PE432       Location/Qualifiers
FT   CDS             652464..653219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0620"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_3157 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63100"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0X1"
FT                   /inference="similar to AA sequence:KEGG:Ava_3157"
FT                   /protein_id="ADI63100.1"
FT                   /translation="MDFPKYMKLFGTVCSGLLMNLPIIPQAVLAKETTSKLNPCPGILY
FT                   EEPYNIRVIVPAVCPPNDLTLILMQLGLLPVPTTPPPYQVRLGVGGEAPAPSALNPNPG
FT                   IFSEQPYNRSQRGFRSGDNVQTVPTLPPSNSLQLPASEQRQDPSARMTLADSKVNIKLI
FT                   NNSGANVTYQVIGDTAPRKLQGKSGVTLRSLSTPVTVTFQREDGGFLMVTPKPGQEKGT
FT                   LEVTLQETSDFNQDRSAMNIQSNGSVFLN"
     MDFPKYMKLF GTVCSGLLMN LPIIPQAVLA KETTSKLNPC PGILYEEPYN IRVIVPAVCP        60
     PNDLTLILMQ LGLLPVPTTP PPYQVRLGVG GEAPAPSALN PNPGIFSEQP YNRSQRGFRS       120
     GDNVQTVPTL PPSNSLQLPA SEQRQDPSAR MTLADSKVNI KLINNSGANV TYQVIGDTAP       180
     RKLQGKSGVT LRSLSTPVTV TFQREDGGFL MVTPKPGQEK GTLEVTLQET SDFNQDRSAM       240
     NIQSNGSVFL N                                                            251
//

If you have problems or comments...

PBIL Back to PBIL home page