(data stored in SCRATCH zone)

EMBL: CP002059.PE441

CP002059.PE441       Location/Qualifiers
FT   CDS             complement(668344..669306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0637"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: ana:all4074
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63109"
FT                   /db_xref="GOA:D7E0Y0"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:D7E0Y0"
FT                   /inference="protein motif:PFAM:PF01435"
FT                   /protein_id="ADI63109.1"
FT                   /translation="MPTYTGISSEAFRHPLDRQAEQALRSLSGFDLIARKFVEFVYERP
FT                   QLVYLMGNTIQVGPRQYSTIYQIFRECVRDLDIYPEPTLFISHNPQANSYALGQENPYI
FT                   VLNTGILDLLNEAEIRAVLAHELGHIKCGHTILIQIAMWAMSAASVIGELTFALGDFVS
FT                   QALIYAFFEWRRKAELSGDRAALLVMDDLDPVMSSMMKISGGSNKYANECSLQEFIQQS
FT                   EKYQALDDDGLNQVYKFLMYNGAQGMMLTHPLPVERLHYLRSWAVSEEYQQVRQGNYQQ
FT                   TPTTRAVNVKVETQENEAEKLRKQIEELQKEINRMKNSD"
     MPTYTGISSE AFRHPLDRQA EQALRSLSGF DLIARKFVEF VYERPQLVYL MGNTIQVGPR        60
     QYSTIYQIFR ECVRDLDIYP EPTLFISHNP QANSYALGQE NPYIVLNTGI LDLLNEAEIR       120
     AVLAHELGHI KCGHTILIQI AMWAMSAASV IGELTFALGD FVSQALIYAF FEWRRKAELS       180
     GDRAALLVMD DLDPVMSSMM KISGGSNKYA NECSLQEFIQ QSEKYQALDD DGLNQVYKFL       240
     MYNGAQGMML THPLPVERLH YLRSWAVSEE YQQVRQGNYQ QTPTTRAVNV KVETQENEAE       300
     KLRKQIEELQ KEINRMKNSD                                                   320
//

If you have problems or comments...

PBIL Back to PBIL home page