(data stored in SCRATCH zone)

EMBL: CP002059.PE461

CP002059.PE461       Location/Qualifiers
FT   CDS             696966..699044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0661"
FT                   /product="translation elongation factor G"
FT                   /note="KEGG: npu:Npun_F3883 protein synthesis factor,
FT                   GTP-binding; TIGRFAM: translation elongation factor G;
FT                   small GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain 2 protein;
FT                   elongation factor G domain IV; elongation factor G domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63129"
FT                   /db_xref="GOA:D7E100"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:D7E100"
FT                   /inference="protein motif:TFAM:TIGR00484"
FT                   /protein_id="ADI63129.1"
FT                   /translation="MARTNPLEKVRNIGIAAHIDAGKTTTTERILFYSGIIHKIGEVHE
FT                   GTAVTDWMDQERERGITITAAAISTSWNDHQINIIDTPGHVDFTIEVERSMRVLDGVIA
FT                   VFCSVGGVQPQSETVWRQADRYKVPRIAFINKMDRTGANFYKVHDQMRDRLRANAIAIQ
FT                   LPIGSETEFKGIVDLVRMCAYMYTNDQGTDIQETEIPAELQGQVTEYRTKLVEAVAETS
FT                   DALMSKYFDGEELTEAEIRTALRKGTIAGTIVPVLCGSAFKNKGVQLMLDAVVNYLPAP
FT                   TEVPPIQGLLPNGDTVERRADDNEPLSALAFKIMADPYGRLTFVRVYSGVLKKGSYVLN
FT                   ASKDKKERISRLVLMKADDRQDVDELRAGDLGAALGLKDTLTGDTLCDEGSPVILESLF
FT                   IPEPVISVAVEPKTKNDMDKLSKALQSLSEEDPTFRVRVDPETNQTVIAGMGELHLEIL
FT                   VDRMLREFKVEANVGAPQVAYRETIRKTVTRIEGKFIRQSGGKGQYGHVVIDLAPGEPG
FT                   TGFEFVSKIVGGSVPKEYINPAEQGMKECCESGVLAGYPLIDVKATLVDGSYHDVDSSE
FT                   MAFKIAGSMAMKEAVAKASPVLLEPMMKVEVEVPENFLGDVMGDLNSRRGQIEGMGSEQ
FT                   GLAKVTAKVPLAEMFGYATDIRSKTQGRGIFSMEFSNYEEVPRNVAEAIIAKSKGNA"
     MARTNPLEKV RNIGIAAHID AGKTTTTERI LFYSGIIHKI GEVHEGTAVT DWMDQERERG        60
     ITITAAAIST SWNDHQINII DTPGHVDFTI EVERSMRVLD GVIAVFCSVG GVQPQSETVW       120
     RQADRYKVPR IAFINKMDRT GANFYKVHDQ MRDRLRANAI AIQLPIGSET EFKGIVDLVR       180
     MCAYMYTNDQ GTDIQETEIP AELQGQVTEY RTKLVEAVAE TSDALMSKYF DGEELTEAEI       240
     RTALRKGTIA GTIVPVLCGS AFKNKGVQLM LDAVVNYLPA PTEVPPIQGL LPNGDTVERR       300
     ADDNEPLSAL AFKIMADPYG RLTFVRVYSG VLKKGSYVLN ASKDKKERIS RLVLMKADDR       360
     QDVDELRAGD LGAALGLKDT LTGDTLCDEG SPVILESLFI PEPVISVAVE PKTKNDMDKL       420
     SKALQSLSEE DPTFRVRVDP ETNQTVIAGM GELHLEILVD RMLREFKVEA NVGAPQVAYR       480
     ETIRKTVTRI EGKFIRQSGG KGQYGHVVID LAPGEPGTGF EFVSKIVGGS VPKEYINPAE       540
     QGMKECCESG VLAGYPLIDV KATLVDGSYH DVDSSEMAFK IAGSMAMKEA VAKASPVLLE       600
     PMMKVEVEVP ENFLGDVMGD LNSRRGQIEG MGSEQGLAKV TAKVPLAEMF GYATDIRSKT       660
     QGRGIFSMEF SNYEEVPRNV AEAIIAKSKG NA                                     692
//

If you have problems or comments...

PBIL Back to PBIL home page