(data stored in SCRATCH zone)

EMBL: CP002059.PE462

CP002059.PE462       Location/Qualifiers
FT   CDS             699067..700296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0662"
FT                   /product="translation elongation factor Tu"
FT                   /note="KEGG: npu:Npun_F3884 protein synthesis factor,
FT                   GTP-binding; TIGRFAM: translation elongation factor Tu;
FT                   small GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain protein;
FT                   elongation factor Tu domain 2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63130"
FT                   /db_xref="GOA:D7E101"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:D7E101"
FT                   /inference="protein motif:TFAM:TIGR00485"
FT                   /protein_id="ADI63130.1"
FT                   /translation="MARAKFERNKPHVNIGTVGHVDHGKTTLTAAITMTLAAMGQAVAK
FT                   GYDQIDNAPEEKARGITINTAHVEYETAGRHYAHVDCPGHADYVKNMITGAAQMDGGIL
FT                   VVAATDGPMPQTREHILLAKQVGVPSLVVFLNKEDLMDDEELLELVELELRELLSSYDF
FT                   PGDDIPIIKGSGLQALEAMTKNPKTQRGENPWVDKIYQLMDAVDSYIPNPERDVDKPFL
FT                   MAVEDVFTITGRGTVATGRIERGKVKVNDTVELIGLKDTRTTTVTGIEMFKKSLDEGMA
FT                   GDNAGVLLRGLKKEDIERGMVIAKPGSITPHTEFEGEVYVLTEKEGGRKTPFFAGYRPQ
FT                   FYVRTTDVTGTIKSYTADDGSAVEMVMPGDRIKMTVELINAIAIEQGMRFAIREGGRTI
FT                   GAGVVSKILK"
     MARAKFERNK PHVNIGTVGH VDHGKTTLTA AITMTLAAMG QAVAKGYDQI DNAPEEKARG        60
     ITINTAHVEY ETAGRHYAHV DCPGHADYVK NMITGAAQMD GGILVVAATD GPMPQTREHI       120
     LLAKQVGVPS LVVFLNKEDL MDDEELLELV ELELRELLSS YDFPGDDIPI IKGSGLQALE       180
     AMTKNPKTQR GENPWVDKIY QLMDAVDSYI PNPERDVDKP FLMAVEDVFT ITGRGTVATG       240
     RIERGKVKVN DTVELIGLKD TRTTTVTGIE MFKKSLDEGM AGDNAGVLLR GLKKEDIERG       300
     MVIAKPGSIT PHTEFEGEVY VLTEKEGGRK TPFFAGYRPQ FYVRTTDVTG TIKSYTADDG       360
     SAVEMVMPGD RIKMTVELIN AIAIEQGMRF AIREGGRTIG AGVVSKILK                   409
//

If you have problems or comments...

PBIL Back to PBIL home page