(data stored in SCRATCH zone)

EMBL: CP002059.PE468

CP002059.PE468       Location/Qualifiers
FT   CDS             complement(704358..706499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0668"
FT                   /product="ribonuclease, Rne/Rng family"
FT                   /note="TIGRFAM: ribonuclease, Rne/Rng family; KEGG:
FT                   npu:Npun_R3890 RNA-binding S1 domain-containing protein;
FT                   PFAM: RNA-binding protein AU-1/Ribonuclease E/G; RNA
FT                   binding S1 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63136"
FT                   /db_xref="GOA:D7E107"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:D7E107"
FT                   /inference="protein motif:TFAM:TIGR00757"
FT                   /protein_id="ADI63136.1"
FT                   /translation="MPKQIIIAEQHQIAAVFSEDQIQELVVATGHHQIGDIYLGVVENV
FT                   LPGIDAAFVNIGDPERNGFIHVTDLGPLKLKRSSAAITELLTPQQKVLVQVMKEPTGTK
FT                   GPRLTGNITLPGRYVVLMPYGRGVNLSRRIKSESERNRLRALAILIKPAGMGVLVRTEA
FT                   EGKPEEAIIEDLELLQKQWEVIQQEAQSTRAPALLNRDDDFIQRVLRDMYGADVNRIVV
FT                   DSSTGLRRVKQYLQNWSGGQTPQGVLIDHHRDRSPILEYFRINAAIREALRPRVDLPSG
FT                   GYIIIEPTEALTVIDVNSGSFTRSATARETVLWTNCEAATEIARQLRLRNIAGVIVVDF
FT                   IDMESRRDQLQVLEHFNKSLKADKARPQIAQLTELGLVELTRKRQGQNIYELFGETCPT
FT                   CGGLGHTVRLPGEIENRMPIPAADIQERFTTPISQREPRMPSTRMSEPRESYDAFGEGL
FT                   EGDAELTPMHLINHPSYQEMGDNKRRTRTRRSRIGINGANGKDENRLGTPLAFVNDSDL
FT                   DLDADSDIAPTPEIPSLLSDTRRERDVMRTPTLGKAGWTERTERTKVKIDPIKPVVEPP
FT                   QIVSVEMTVQEQDMFALMGISPSVKLEQEVKNPKSVIFNIVQPGQTSTSTTESTSTSES
FT                   ISELTVSERTNSELTKVKIPIPKVEVEELSLEPLIIDPPVQESSTIGFESFTDEEELSS
FT                   TSSTPNRRRRRRSSAIEEN"
     MPKQIIIAEQ HQIAAVFSED QIQELVVATG HHQIGDIYLG VVENVLPGID AAFVNIGDPE        60
     RNGFIHVTDL GPLKLKRSSA AITELLTPQQ KVLVQVMKEP TGTKGPRLTG NITLPGRYVV       120
     LMPYGRGVNL SRRIKSESER NRLRALAILI KPAGMGVLVR TEAEGKPEEA IIEDLELLQK       180
     QWEVIQQEAQ STRAPALLNR DDDFIQRVLR DMYGADVNRI VVDSSTGLRR VKQYLQNWSG       240
     GQTPQGVLID HHRDRSPILE YFRINAAIRE ALRPRVDLPS GGYIIIEPTE ALTVIDVNSG       300
     SFTRSATARE TVLWTNCEAA TEIARQLRLR NIAGVIVVDF IDMESRRDQL QVLEHFNKSL       360
     KADKARPQIA QLTELGLVEL TRKRQGQNIY ELFGETCPTC GGLGHTVRLP GEIENRMPIP       420
     AADIQERFTT PISQREPRMP STRMSEPRES YDAFGEGLEG DAELTPMHLI NHPSYQEMGD       480
     NKRRTRTRRS RIGINGANGK DENRLGTPLA FVNDSDLDLD ADSDIAPTPE IPSLLSDTRR       540
     ERDVMRTPTL GKAGWTERTE RTKVKIDPIK PVVEPPQIVS VEMTVQEQDM FALMGISPSV       600
     KLEQEVKNPK SVIFNIVQPG QTSTSTTEST STSESISELT VSERTNSELT KVKIPIPKVE       660
     VEELSLEPLI IDPPVQESST IGFESFTDEE ELSSTSSTPN RRRRRRSSAI EEN              713
//

If you have problems or comments...

PBIL Back to PBIL home page