(data stored in SCRATCH zone)

EMBL: CP002059.PE48

CP002059.PE48        Location/Qualifiers
FT   CDS             53663..54535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0062"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: Abortive infection protein; KEGG: ava:Ava_0525
FT                   abortive infection protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62716"
FT                   /db_xref="GOA:D7DVE1"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVE1"
FT                   /inference="protein motif:PFAM:PF02517"
FT                   /protein_id="ADI62716.1"
FT                   /translation="MIFLSAFLSLLEPSVNTLLAFLKNAPVVFLVMAFFIVWVGCWLPL
FT                   AGIITVLLNWQVNKPLQTEQKIPLLVSLYSLAPLILWGVNWLGFGSFADYGLVENHTIW
FT                   VSLLLGFGLGVLGLVMLFTCQLWLGWCYLEKSNIKLIPSILLPIYLVALFVGGIEELVF
FT                   RGFLLTTLEKDYPIWMAAIISSLIFALLHLVWEQRETLPEIPGLWLMGMVLVVARLADN
FT                   KNLGIAWGLHAGWVWVIATIDTAGLITYTGKVSDWFTGKNKKSLAGLAGVLYVLATGVI
FT                   LWWFSQNEF"
     MIFLSAFLSL LEPSVNTLLA FLKNAPVVFL VMAFFIVWVG CWLPLAGIIT VLLNWQVNKP        60
     LQTEQKIPLL VSLYSLAPLI LWGVNWLGFG SFADYGLVEN HTIWVSLLLG FGLGVLGLVM       120
     LFTCQLWLGW CYLEKSNIKL IPSILLPIYL VALFVGGIEE LVFRGFLLTT LEKDYPIWMA       180
     AIISSLIFAL LHLVWEQRET LPEIPGLWLM GMVLVVARLA DNKNLGIAWG LHAGWVWVIA       240
     TIDTAGLITY TGKVSDWFTG KNKKSLAGLA GVLYVLATGV ILWWFSQNEF                  290
//

If you have problems or comments...

PBIL Back to PBIL home page