(data stored in SCRATCH zone)

EMBL: CP002059.PE480

CP002059.PE480       Location/Qualifiers
FT   CDS             complement(717061..718464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0680"
FT                   /product="NAD(P)(+) transhydrogenase (AB-specific)"
FT                   /EC_number="1.6.1.2"
FT                   /note="KEGG: npu:Npun_F1592 NAD(P) transhydrogenase, beta
FT                   subunit; PFAM: NAD(P) transhydrogenase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0680"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63148"
FT                   /db_xref="GOA:D7E119"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:D7E119"
FT                   /inference="protein motif:PRIAM:1.6.1.2"
FT                   /protein_id="ADI63148.1"
FT                   /translation="MSDFLPTGIQLTYLVAASLFILGLKKLGSPATARNGNLVAAVGML
FT                   LAIIATMLDQQVLNYEMILVGLSIGSVIGAVVAYKVQMTEMPQMVGLLNGLGGASSALI
FT                   AVAEFSRLLGSSQPIPLHVNISMLLDVLIGGVTLTGSFLAFAKLQGLVSGTPITFPLQQ
FT                   PFNLFLLGTYIAGSAYLIMSPDSLPIFLAVVAVSLVLGVMFVLPIGGGDMPVVISLLNS
FT                   LSGVAAAAAGFVVMNNMLIIAGALVGASGLILTEIMCKAMNRSLFSVLFSAFGSVSTAT
FT                   GDAVAGASNQTVRSIDPEEGAMMLGYARSVVIVPGYGMAVAQAQHSVRELADQLERMGV
FT                   DIKYAIHPVAGRMPGHMNVLLAEANVAYTQLYDMDDINPQFQQADVALVIGANDVVNPA
FT                   ARNDTNSPIYGMPILEVDRAKQTIVIKRGMSAGFAGVDNELFYKDNTTMLFGSAKDMVA
FT                   KLVSEVKQL"
     MSDFLPTGIQ LTYLVAASLF ILGLKKLGSP ATARNGNLVA AVGMLLAIIA TMLDQQVLNY        60
     EMILVGLSIG SVIGAVVAYK VQMTEMPQMV GLLNGLGGAS SALIAVAEFS RLLGSSQPIP       120
     LHVNISMLLD VLIGGVTLTG SFLAFAKLQG LVSGTPITFP LQQPFNLFLL GTYIAGSAYL       180
     IMSPDSLPIF LAVVAVSLVL GVMFVLPIGG GDMPVVISLL NSLSGVAAAA AGFVVMNNML       240
     IIAGALVGAS GLILTEIMCK AMNRSLFSVL FSAFGSVSTA TGDAVAGASN QTVRSIDPEE       300
     GAMMLGYARS VVIVPGYGMA VAQAQHSVRE LADQLERMGV DIKYAIHPVA GRMPGHMNVL       360
     LAEANVAYTQ LYDMDDINPQ FQQADVALVI GANDVVNPAA RNDTNSPIYG MPILEVDRAK       420
     QTIVIKRGMS AGFAGVDNEL FYKDNTTMLF GSAKDMVAKL VSEVKQL                     467
//

If you have problems or comments...

PBIL Back to PBIL home page