(data stored in SCRATCH zone)

EMBL: CP002059.PE483

CP002059.PE483       Location/Qualifiers
FT   CDS             721156..721668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0683"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_3431 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0683"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63151"
FT                   /db_xref="InterPro:IPR021256"
FT                   /db_xref="UniProtKB/TrEMBL:D7E122"
FT                   /inference="similar to AA sequence:KEGG:Ava_3431"
FT                   /protein_id="ADI63151.1"
FT                   /translation="MRHLLSALAVTGYLLTSLTATSVAQSLPGLTLLSGVKSENQLPFR
FT                   LDFGGQTASTDRYILRLPAKKMKLAVAQFAITYPKYYKGTFDTKKVEVRVKDKSVPLSE
FT                   VKWDKEGRVIEILPQKLVPAGTNVELVLSNVQNPTFGGIFYFNCQVLSPGDVPLLRYLG
FT                   SWIISIS"
     MRHLLSALAV TGYLLTSLTA TSVAQSLPGL TLLSGVKSEN QLPFRLDFGG QTASTDRYIL        60
     RLPAKKMKLA VAQFAITYPK YYKGTFDTKK VEVRVKDKSV PLSEVKWDKE GRVIEILPQK       120
     LVPAGTNVEL VLSNVQNPTF GGIFYFNCQV LSPGDVPLLR YLGSWIISIS                  170
//

If you have problems or comments...

PBIL Back to PBIL home page