(data stored in SCRATCH zone)

EMBL: CP002059.PE490

CP002059.PE490       Location/Qualifiers
FT   CDS             728552..730063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0693"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="KEGG: npu:Npun_R1580 ATPase central
FT                   domain-containing protein; PFAM: AAA ATPase central domain
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0693"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63158"
FT                   /db_xref="GOA:D7E129"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7E129"
FT                   /inference="protein motif:PFAM:PF00004"
FT                   /protein_id="ADI63158.1"
FT                   /translation="MNFRDEFKLLLRARYSLIYVPTYEEERVEAAIREEATNQGNRPVY
FT                   TWDFVDGYQGNPNDAGFGRRNPLQALEFIEKLPATAPAVLILRDYHRFLDDVAISRKLR
FT                   NLARLLKSQPKNIVLLSPRIAIPDDLMEVLTVVEFPLPAAPEIKTEVERLLQTTGNSPS
FT                   GKFLDDLVHSCQGLSMERIRRVLARAIASHGELQLEDVDLVLEEKRQTIRQTQILDFYP
FT                   AIEQISDIGGLDNLKDWLIRRGGSLTERARQYGLPHPRGLMLVGIQGTGKSLTAKAIAH
FT                   HWHLPLLRLDVGRLFGGLVGESESRTRQMIQVAEALAPCVLWIDEIDKAFSGLGSKGDA
FT                   GTTSRVFGTFITWLAEKTSPVFVVATANDIQALPPEMLRKGRFDEIFFVGLPTQEERKA
FT                   IFKVHLSRLRPHNLNSYEIDRLAYETPDFSGAEIEQTLTEAMHIGFSQNRDFTTDDILE
FT                   AASQIIPLARTAVEQIQKLQEWAAAGRARLASKHSPLSERIQRQM"
     MNFRDEFKLL LRARYSLIYV PTYEEERVEA AIREEATNQG NRPVYTWDFV DGYQGNPNDA        60
     GFGRRNPLQA LEFIEKLPAT APAVLILRDY HRFLDDVAIS RKLRNLARLL KSQPKNIVLL       120
     SPRIAIPDDL MEVLTVVEFP LPAAPEIKTE VERLLQTTGN SPSGKFLDDL VHSCQGLSME       180
     RIRRVLARAI ASHGELQLED VDLVLEEKRQ TIRQTQILDF YPAIEQISDI GGLDNLKDWL       240
     IRRGGSLTER ARQYGLPHPR GLMLVGIQGT GKSLTAKAIA HHWHLPLLRL DVGRLFGGLV       300
     GESESRTRQM IQVAEALAPC VLWIDEIDKA FSGLGSKGDA GTTSRVFGTF ITWLAEKTSP       360
     VFVVATANDI QALPPEMLRK GRFDEIFFVG LPTQEERKAI FKVHLSRLRP HNLNSYEIDR       420
     LAYETPDFSG AEIEQTLTEA MHIGFSQNRD FTTDDILEAA SQIIPLARTA VEQIQKLQEW       480
     AAAGRARLAS KHSPLSERIQ RQM                                               503
//

If you have problems or comments...

PBIL Back to PBIL home page