(data stored in SCRATCH zone)

EMBL: CP002059.PE502

CP002059.PE502       Location/Qualifiers
FT   CDS             746828..748288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0710"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="SMART: Cysteinyl-tRNA synthetase class Ia DALR;
FT                   TIGRFAM: cysteinyl-tRNA synthetase; KEGG: npu:Npun_F3946
FT                   cysteinyl-tRNA synthetase; PFAM: Cysteinyl-tRNA synthetase
FT                   class Ia; Cysteinyl-tRNA synthetase class Ia DALR"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0710"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63170"
FT                   /db_xref="GOA:D7E141"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:D7E141"
FT                   /inference="protein motif:TFAM:TIGR00435"
FT                   /protein_id="ADI63170.1"
FT                   /translation="MTLSIYNTLTRRQEPFTTVEPGKVKMYCCGVTVYDYCHLGHARAC
FT                   IIWDVVRRYLQLIGYDVRYIQNFTDIDDKILNRARQEKSTMEAVAERYIQAYFEDMSRL
FT                   GIKEANEYPRATHTMNGIQRLIHDLEHKGFAYPANGDVYYAVQKFDEYGKLSGRKLEDL
FT                   QLGASERVNIEDAEYQKKQYPFDFALWKAVKQGEPAWESPWGKGRPGWHIECSAMVRER
FT                   LGDTIDIHTGGADLIFPHHENEIAQSEAVTGKPLANYWLHNGMVKVDGEKMSKSLGNFT
FT                   TIRNLLDRGVDPMALRLFVLMAQYRKPIDFTDEAILAATNGWYTLRQGLLFGYQYGKKL
FT                   GTGEWGLGIRNNLTSNTYIERFKEVVNDDFNFPGGLAVIFELAKELIREKNIIVHQGKT
FT                   ETPPDKLLQEWQTLVTLADVLGLTAQLEIETISEDALTDAEIEDLIQKRQEARKGKNFA
FT                   ESDCIRDDLLSKGITLIDNCEGTRWHRG"
     MTLSIYNTLT RRQEPFTTVE PGKVKMYCCG VTVYDYCHLG HARACIIWDV VRRYLQLIGY        60
     DVRYIQNFTD IDDKILNRAR QEKSTMEAVA ERYIQAYFED MSRLGIKEAN EYPRATHTMN       120
     GIQRLIHDLE HKGFAYPANG DVYYAVQKFD EYGKLSGRKL EDLQLGASER VNIEDAEYQK       180
     KQYPFDFALW KAVKQGEPAW ESPWGKGRPG WHIECSAMVR ERLGDTIDIH TGGADLIFPH       240
     HENEIAQSEA VTGKPLANYW LHNGMVKVDG EKMSKSLGNF TTIRNLLDRG VDPMALRLFV       300
     LMAQYRKPID FTDEAILAAT NGWYTLRQGL LFGYQYGKKL GTGEWGLGIR NNLTSNTYIE       360
     RFKEVVNDDF NFPGGLAVIF ELAKELIREK NIIVHQGKTE TPPDKLLQEW QTLVTLADVL       420
     GLTAQLEIET ISEDALTDAE IEDLIQKRQE ARKGKNFAES DCIRDDLLSK GITLIDNCEG       480
     TRWHRG                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page