(data stored in SCRATCH zone)

EMBL: CP002059.PE522

CP002059.PE522       Location/Qualifiers
FT   CDS             complement(779173..780693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0738"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   npu:Npun_R2846 peptidase M16 domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0738"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63190"
FT                   /db_xref="GOA:D7E1G3"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1G3"
FT                   /inference="protein motif:PFAM:PF00675"
FT                   /protein_id="ADI63190.1"
FT                   /translation="MLNFLVKGRKLKFSLKFSKSWRFISAFVVACLLTFNFPWAATATA
FT                   KHYTDLQFTPLSEVKLPKYERFVLDNGLVVYLMEDHELPLVSGTTLVRTGSRWEAGDKS
FT                   GLAEIVGSVMRTGGTLKHSADELNEILEQRAAAVEISIGEAVGSASFDSLSEDLETVFG
FT                   LFAEVLREPAFAQEKLDLEKTQTKGSIARRNDDPSSIANREFKKLIYGQDSPYSRTVEY
FT                   ATLEKITREDLLRFYQQYFYPNKMILGIVGDFNAKKMRSLIQAKFGDWKPNPKISKTLL
FT                   PEVSQANLGGVFFVNQPQLTQSNILIGHLGGSFNNPDYPALDVMNGVLNGFGGRLFNEV
FT                   RSRQGLAYSVYGSWSPRHDYPGMFIAGGQTRSDATVQFIKSLEAEIKRMQNEKVTTQEL
FT                   NYAKDSTLNSFVFNFQDPSQTLSRLMRYEYYGYPADFLFHYQKAVTATTTADIQRVAKK
FT                   YLKPENLVTLVVGNQTAIQPPLTQLAAKVTPVDVTIPGSQTQAQNSSK"
     MLNFLVKGRK LKFSLKFSKS WRFISAFVVA CLLTFNFPWA ATATAKHYTD LQFTPLSEVK        60
     LPKYERFVLD NGLVVYLMED HELPLVSGTT LVRTGSRWEA GDKSGLAEIV GSVMRTGGTL       120
     KHSADELNEI LEQRAAAVEI SIGEAVGSAS FDSLSEDLET VFGLFAEVLR EPAFAQEKLD       180
     LEKTQTKGSI ARRNDDPSSI ANREFKKLIY GQDSPYSRTV EYATLEKITR EDLLRFYQQY       240
     FYPNKMILGI VGDFNAKKMR SLIQAKFGDW KPNPKISKTL LPEVSQANLG GVFFVNQPQL       300
     TQSNILIGHL GGSFNNPDYP ALDVMNGVLN GFGGRLFNEV RSRQGLAYSV YGSWSPRHDY       360
     PGMFIAGGQT RSDATVQFIK SLEAEIKRMQ NEKVTTQELN YAKDSTLNSF VFNFQDPSQT       420
     LSRLMRYEYY GYPADFLFHY QKAVTATTTA DIQRVAKKYL KPENLVTLVV GNQTAIQPPL       480
     TQLAAKVTPV DVTIPGSQTQ AQNSSK                                            506
//

If you have problems or comments...

PBIL Back to PBIL home page