(data stored in SCRATCH zone)

EMBL: CP002059.PE523

CP002059.PE523       Location/Qualifiers
FT   CDS             complement(780888..782507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0739"
FT                   /product="processing peptidase"
FT                   /EC_number="3.4.24.64"
FT                   /note="KEGG: npu:Npun_R2847 peptidase M16 domain-containing
FT                   protein; PFAM: peptidase M16 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0739"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63191"
FT                   /db_xref="GOA:D7E1G4"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1G4"
FT                   /inference="protein motif:PRIAM:3.4.24.64"
FT                   /protein_id="ADI63191.1"
FT                   /translation="MNYSILDSWKSKTNKSQFRYSQLFHKFPFSPVLHRLLITALAVMI
FT                   FCLGVTPQAAIALEPTQSLIQPYLDQVVKQLTEFRLDNGLKFIVLERHQVPVVSFLTYA
FT                   DVGGIDESDGKTGVAHFLEHLAFKGTKRIGTIDYKAEKPLLESLEQLDTQIRTAKSQGK
FT                   NDDLAKLETEFKSLESQALKLVKQNEIGQIVEQAGGVGLNANTSTEATRYFYSFPANKL
FT                   ELWMSLESERFLDPVFREFYKEKDVILEERRMRVENSPVGLMVEKFIDTAFKVHPYRRP
FT                   VIGYDEDIRNLSPKDVKQFFDSYYVPNNLVIAIVGDVKPNEVKKLAQVYFGRYPAKLKA
FT                   QAKITPEPKQTEPREFTLKLPTQPWYFQGYHRPGITHPDNAVYDIIGSLLSDGRTSRLY
FT                   KSLVEKQSLALAAHGVSGFPGDKYPNLILFYALTSPGHTVDDLAIALGKEIEKLKTEPV
FT                   STTELQRVKTQARAGLLRSLDSNMGMAQQLLEYEVKTGSWRNLFKQLENIAAVTPADIQ
FT                   RVAQVTFTRENCTVGKLLSKEG"
     MNYSILDSWK SKTNKSQFRY SQLFHKFPFS PVLHRLLITA LAVMIFCLGV TPQAAIALEP        60
     TQSLIQPYLD QVVKQLTEFR LDNGLKFIVL ERHQVPVVSF LTYADVGGID ESDGKTGVAH       120
     FLEHLAFKGT KRIGTIDYKA EKPLLESLEQ LDTQIRTAKS QGKNDDLAKL ETEFKSLESQ       180
     ALKLVKQNEI GQIVEQAGGV GLNANTSTEA TRYFYSFPAN KLELWMSLES ERFLDPVFRE       240
     FYKEKDVILE ERRMRVENSP VGLMVEKFID TAFKVHPYRR PVIGYDEDIR NLSPKDVKQF       300
     FDSYYVPNNL VIAIVGDVKP NEVKKLAQVY FGRYPAKLKA QAKITPEPKQ TEPREFTLKL       360
     PTQPWYFQGY HRPGITHPDN AVYDIIGSLL SDGRTSRLYK SLVEKQSLAL AAHGVSGFPG       420
     DKYPNLILFY ALTSPGHTVD DLAIALGKEI EKLKTEPVST TELQRVKTQA RAGLLRSLDS       480
     NMGMAQQLLE YEVKTGSWRN LFKQLENIAA VTPADIQRVA QVTFTRENCT VGKLLSKEG        539
//

If you have problems or comments...

PBIL Back to PBIL home page