(data stored in SCRATCH zone)

EMBL: CP002059.PE531

CP002059.PE531       Location/Qualifiers
FT   CDS             complement(800637..800894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0756"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ana:all0364 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0756"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63199"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1H2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI63199.1"
FT                   /translation="MSVAGVAKITLLPHVMKSCCSPLNSTALIYSIGVTRATDGLQPLI
FT                   YNTSNGALFFDTDGNCADLSVRIPTLSTQQFLSNSDITVI"
     MSVAGVAKIT LLPHVMKSCC SPLNSTALIY SIGVTRATDG LQPLIYNTSN GALFFDTDGN        60
     CADLSVRIPT LSTQQFLSNS DITVI                                              85
//

If you have problems or comments...

PBIL Back to PBIL home page