(data stored in SCRATCH zone)

EMBL: CP002059.PE54

CP002059.PE54        Location/Qualifiers
FT   CDS             58757..59650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0068"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   npu:Npun_R6133 alpha/beta hydrolase fold protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62722"
FT                   /db_xref="GOA:D7DVB4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVB4"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADI62722.1"
FT                   /translation="MTTYTNAFISTKTWTWQGFPISYQTQGNAGPAVILVHGFGASWLH
FT                   WRKNIPALAEKCRVYAIDLIGFGASAKPVPGERITYTLESWGQQIADFCREVVGEPAFL
FT                   VGNSIGCIVVMQAAVSNPDIALGTALLNCSLRLLHDCKRVTLPWTKRVGAPILQKLLSI
FT                   PTVGEFFFSQLAKPKTVRKILLQAYGNGETVTDELVDILMKPANDPGAAAVFLAFTSYS
FT                   SGPLPEDLLPVLSCPAIILWGTADPWEPINLGKELANFPQVQKFIALDGVGHCPQDEAP
FT                   ELVNPILQDWIRELSI"
     MTTYTNAFIS TKTWTWQGFP ISYQTQGNAG PAVILVHGFG ASWLHWRKNI PALAEKCRVY        60
     AIDLIGFGAS AKPVPGERIT YTLESWGQQI ADFCREVVGE PAFLVGNSIG CIVVMQAAVS       120
     NPDIALGTAL LNCSLRLLHD CKRVTLPWTK RVGAPILQKL LSIPTVGEFF FSQLAKPKTV       180
     RKILLQAYGN GETVTDELVD ILMKPANDPG AAAVFLAFTS YSSGPLPEDL LPVLSCPAII       240
     LWGTADPWEP INLGKELANF PQVQKFIALD GVGHCPQDEA PELVNPILQD WIRELSI          297
//

If you have problems or comments...

PBIL Back to PBIL home page