(data stored in SCRATCH zone)

EMBL: CP002059.PE540

CP002059.PE540       Location/Qualifiers
FT   CDS             complement(819001..819543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0775"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:all2724 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0775"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63208"
FT                   /db_xref="GOA:D7E1I1"
FT                   /db_xref="InterPro:IPR004313"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1I1"
FT                   /inference="similar to AA sequence:KEGG:all2724"
FT                   /protein_id="ADI63208.1"
FT                   /translation="MAILLLDNGITESNFSEIVHELKSLNIKLRNYELGTSLLSSELLE
FT                   QETVTESEKLYIIELHNSLFEFLQKETDYHWSDLLNIHPGSTNLETWIVTYGRYHTHNA
FT                   AEVIYLLAGEMIYGFVKPDGSQVQLLLQHQDYLYIPIGVEHWCSPSASLHFKVIRYFTT
FT                   VEGWMPNYTGTHQQFKI"
     MAILLLDNGI TESNFSEIVH ELKSLNIKLR NYELGTSLLS SELLEQETVT ESEKLYIIEL        60
     HNSLFEFLQK ETDYHWSDLL NIHPGSTNLE TWIVTYGRYH THNAAEVIYL LAGEMIYGFV       120
     KPDGSQVQLL LQHQDYLYIP IGVEHWCSPS ASLHFKVIRY FTTVEGWMPN YTGTHQQFKI       180
//

If you have problems or comments...

PBIL Back to PBIL home page