(data stored in SCRATCH zone)

EMBL: CP002059.PE545

CP002059.PE545       Location/Qualifiers
FT   CDS             complement(835831..836631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0782"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ava:Ava_1833 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0782"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63213"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1I6"
FT                   /inference="similar to AA sequence:KEGG:Ava_1833"
FT                   /protein_id="ADI63213.1"
FT                   /translation="MLKTMTANNPTILALDFDGVICDGLIEYFEVAWRTYHQIWLSSAT
FT                   DIRPYDLALRFYRLRPVIETGWEMPVLIKALIEGFSDDKILQDWTNITSQILTADNLDA
FT                   KEVAKKLDTLRDEWIKADLDSWLNLHKFYPGVIEKLKMTVTSEVQLYIITTKEGRFVQH
FT                   LLRKEGVHLPTTAIFGKEVKRPKYETLRQLIEKSEHSSVSVWFVEDRLKTLQLIQKQSD
FT                   LNHVQLFLADWGYNTQRERQTGNNDQRIKLISLSHFAHDFSKWS"
     MLKTMTANNP TILALDFDGV ICDGLIEYFE VAWRTYHQIW LSSATDIRPY DLALRFYRLR        60
     PVIETGWEMP VLIKALIEGF SDDKILQDWT NITSQILTAD NLDAKEVAKK LDTLRDEWIK       120
     ADLDSWLNLH KFYPGVIEKL KMTVTSEVQL YIITTKEGRF VQHLLRKEGV HLPTTAIFGK       180
     EVKRPKYETL RQLIEKSEHS SVSVWFVEDR LKTLQLIQKQ SDLNHVQLFL ADWGYNTQRE       240
     RQTGNNDQRI KLISLSHFAH DFSKWS                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page