(data stored in SCRATCH zone)

EMBL: CP002059.PE563

CP002059.PE563       Location/Qualifiers
FT   CDS             854630..855244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0808"
FT                   /product="Lipoprotein LpqB, GerMN domain protein"
FT                   /note="PFAM: Lipoprotein LpqB, GerMN domain; KEGG:
FT                   ana:alr5055 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0808"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63231"
FT                   /db_xref="GOA:D7E1K4"
FT                   /db_xref="InterPro:IPR019606"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1K4"
FT                   /inference="protein motif:PFAM:PF10646"
FT                   /protein_id="ADI63231.1"
FT                   /translation="MNDQQRTNRNVSSGVIAAVSAAVVAVSGGVAWLTSQTPNTSTPGN
FT                   PSQSIKQPQKPLTTKPGNEQSANIYWLRPTEKSLELVPQPVKIAAAQPNQALEAAFKTL
FT                   LAGPTEGSDSTTIPKGTQLLGLKVENNDVHVNLSEDFTSGGGSTSMLGRIGQVVYTATT
FT                   LNPNAKVYIEVNGKQLDVLGGEGVELQQPLTRETFNKNYPL"
     MNDQQRTNRN VSSGVIAAVS AAVVAVSGGV AWLTSQTPNT STPGNPSQSI KQPQKPLTTK        60
     PGNEQSANIY WLRPTEKSLE LVPQPVKIAA AQPNQALEAA FKTLLAGPTE GSDSTTIPKG       120
     TQLLGLKVEN NDVHVNLSED FTSGGGSTSM LGRIGQVVYT ATTLNPNAKV YIEVNGKQLD       180
     VLGGEGVELQ QPLTRETFNK NYPL                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page