(data stored in SCRATCH zone)

EMBL: CP002059.PE577

CP002059.PE577       Location/Qualifiers
FT   CDS             complement(867658..869073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0822"
FT                   /product="inorganic carbon transporter"
FT                   /note="KEGG: npu:Npun_R0453 O-antigen polymerase; TIGRFAM:
FT                   inorganic carbon transporter; PFAM: O-antigen polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0822"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63245"
FT                   /db_xref="GOA:D7E1L8"
FT                   /db_xref="InterPro:IPR006007"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1L8"
FT                   /inference="protein motif:TFAM:TIGR00947"
FT                   /protein_id="ADI63245.1"
FT                   /translation="MNLVWQRFTLSSLPLKEYLNTSYLHRFMVGILRPWRQTSLLMQWG
FT                   DTIAAALLSLVYALAPFVSTTLMLVLLLACIGFWLLLTLSDETTSVNVASVTPIHLLVL
FT                   LYWGIAAIATALSPVKKAALSDLATLSLYLLLFTVCARVLRFSRMRSWLITLYLHTSLI
FT                   VSVYGIRQWFFGAKALATWVDPESPLSKTTRVYSYLGNPNLLAGYLLPAVVLSLVAIFA
FT                   WQGWFKKTLAVTMFAVNTICLVLTYSRGGWIALVVAFLTGMALLVYWWSLEMPPFWRTW
FT                   SLPIILGSLIGVLVLAMIFVEPVRLRVVSIFADRQDSSNNFRRNVWDAVFRMIGDRPII
FT                   GIGPGHHSFNKVYPLYQQPRYTALSAYSIFLEVAVETGFMGLACFLWLIIVTFNTAFIQ
FT                   LQRFRESRSIEGFWVIGAIAALLGMLAHGMVDTVWYRPSLNTLWWLMVALVASYWTPLS
FT                   QTTNQPNPEPGLK"
     MNLVWQRFTL SSLPLKEYLN TSYLHRFMVG ILRPWRQTSL LMQWGDTIAA ALLSLVYALA        60
     PFVSTTLMLV LLLACIGFWL LLTLSDETTS VNVASVTPIH LLVLLYWGIA AIATALSPVK       120
     KAALSDLATL SLYLLLFTVC ARVLRFSRMR SWLITLYLHT SLIVSVYGIR QWFFGAKALA       180
     TWVDPESPLS KTTRVYSYLG NPNLLAGYLL PAVVLSLVAI FAWQGWFKKT LAVTMFAVNT       240
     ICLVLTYSRG GWIALVVAFL TGMALLVYWW SLEMPPFWRT WSLPIILGSL IGVLVLAMIF       300
     VEPVRLRVVS IFADRQDSSN NFRRNVWDAV FRMIGDRPII GIGPGHHSFN KVYPLYQQPR       360
     YTALSAYSIF LEVAVETGFM GLACFLWLII VTFNTAFIQL QRFRESRSIE GFWVIGAIAA       420
     LLGMLAHGMV DTVWYRPSLN TLWWLMVALV ASYWTPLSQT TNQPNPEPGL K                471
//

If you have problems or comments...

PBIL Back to PBIL home page