(data stored in SCRATCH zone)

EMBL: CP002059.PE595

CP002059.PE595       Location/Qualifiers
FT   CDS             894784..895818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0843"
FT                   /product="periplasmic solute binding protein"
FT                   /note="PFAM: periplasmic solute binding protein; KEGG:
FT                   ana:alr3576 adhesin precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0843"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63263"
FT                   /db_xref="GOA:D7E1N6"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1N6"
FT                   /inference="protein motif:PFAM:PF01297"
FT                   /protein_id="ADI63263.1"
FT                   /translation="MKQILGIKGNTVLKKTKISQLCLGMLLPLALFSCNPSDSQAPGNG
FT                   KRHVVATSTIIADLAQEVAGEEVKVTGILKPGADPHVYEPVPADSRVLETADLILYNGY
FT                   KLEPGIIKLMNAVGGKARKLAVGEVIKPLKLQKSKGEIVPDPHIWGSVENVISMVKAIK
FT                   EALIELSPEDKDKFTQKAAELTEELQQFNNWITQQIQTIPPEKRKLITTHDAFQYYGSN
FT                   YGMEIAGTLIGISTEEQPSAQTVSKLVDSVKKIGVPAIFAETTINPALITTVAQEVGVK
FT                   LVKNQLYSDSIGAKGSDGDTYIKMMEANTRTIVEALGGKYTPFVLKGASGFGRKTQIGG
FT                   KPLR"
     MKQILGIKGN TVLKKTKISQ LCLGMLLPLA LFSCNPSDSQ APGNGKRHVV ATSTIIADLA        60
     QEVAGEEVKV TGILKPGADP HVYEPVPADS RVLETADLIL YNGYKLEPGI IKLMNAVGGK       120
     ARKLAVGEVI KPLKLQKSKG EIVPDPHIWG SVENVISMVK AIKEALIELS PEDKDKFTQK       180
     AAELTEELQQ FNNWITQQIQ TIPPEKRKLI TTHDAFQYYG SNYGMEIAGT LIGISTEEQP       240
     SAQTVSKLVD SVKKIGVPAI FAETTINPAL ITTVAQEVGV KLVKNQLYSD SIGAKGSDGD       300
     TYIKMMEANT RTIVEALGGK YTPFVLKGAS GFGRKTQIGG KPLR                        344
//

If you have problems or comments...

PBIL Back to PBIL home page