(data stored in SCRATCH zone)

EMBL: CP002059.PE597

CP002059.PE597       Location/Qualifiers
FT   CDS             complement(897805..899418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0846"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   ava:Ava_3962 MscS mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0846"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63265"
FT                   /db_xref="GOA:D7E1N8"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1N8"
FT                   /inference="protein motif:PFAM:PF00924"
FT                   /protein_id="ADI63265.1"
FT                   /translation="MRLKFLAIAVSMGVTVISVQKTTARTPLLPYLQTPSNLSNSTGNQ
FT                   TVSEWIYLDGRPLFQIAASKNDVSERLQSIQQNLQEISQDYFQSKAPEFKIQIRTTKDL
FT                   PVIYINGKYLMTINSQDAKLRQLKALTLANEIADNLQDNLEVSKKERQTSSLISQCKIA
FT                   GAIALVMILSSSLIYRYQRRSQKDDVEPICPDAETGQPITTQLNQQEHQHLAEVKNRLF
FT                   QLSQTGIWGGGSFVILGLFPYTRALQMALLAVAQIPLKVGIVVLGTYVAVRFSYALIDK
FT                   FTTTLISGGFLLNSETSERMELRVSTFSGVTKSITTLICMGVGILSILISLGIDIVPLL
FT                   AGAGLIGVAVSLASQNLIKDAINGFLIIIEDQYALGDVINVGNVGGLVENLNLRMTQVR
FT                   DAEGRLITIPNSEIKVVANLSSRWSRADLTIPVSYQANIDEALKLIEDVALNMNQEPKW
FT                   KREIIEKPSILGIDNFSERGMMIRVWIKTQPLKQWEVAREYRRRLKIALDQVGISIPIP
FT                   QQTILVNHPQLLNSARNNSD"
     MRLKFLAIAV SMGVTVISVQ KTTARTPLLP YLQTPSNLSN STGNQTVSEW IYLDGRPLFQ        60
     IAASKNDVSE RLQSIQQNLQ EISQDYFQSK APEFKIQIRT TKDLPVIYIN GKYLMTINSQ       120
     DAKLRQLKAL TLANEIADNL QDNLEVSKKE RQTSSLISQC KIAGAIALVM ILSSSLIYRY       180
     QRRSQKDDVE PICPDAETGQ PITTQLNQQE HQHLAEVKNR LFQLSQTGIW GGGSFVILGL       240
     FPYTRALQMA LLAVAQIPLK VGIVVLGTYV AVRFSYALID KFTTTLISGG FLLNSETSER       300
     MELRVSTFSG VTKSITTLIC MGVGILSILI SLGIDIVPLL AGAGLIGVAV SLASQNLIKD       360
     AINGFLIIIE DQYALGDVIN VGNVGGLVEN LNLRMTQVRD AEGRLITIPN SEIKVVANLS       420
     SRWSRADLTI PVSYQANIDE ALKLIEDVAL NMNQEPKWKR EIIEKPSILG IDNFSERGMM       480
     IRVWIKTQPL KQWEVAREYR RRLKIALDQV GISIPIPQQT ILVNHPQLLN SARNNSD          537
//

If you have problems or comments...

PBIL Back to PBIL home page