(data stored in SCRATCH zone)

EMBL: CP002059.PE608

CP002059.PE608       Location/Qualifiers
FT   CDS             complement(916581..918476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0861"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /EC_number="3.5.1.28"
FT                   /note="PFAM: cell wall hydrolase/autolysin; KEGG:
FT                   ana:alr0093 N-acetylmuramoyl-L-alanine amidase; SMART: cell
FT                   wall hydrolase/autolysin"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0861"
FT                   /db_xref="EnsemblGenomes-Tr:ADI63276"
FT                   /db_xref="GOA:D7E1P9"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="UniProtKB/TrEMBL:D7E1P9"
FT                   /inference="protein motif:PRIAM:3.5.1.28"
FT                   /protein_id="ADI63276.1"
FT                   /translation="MKLHWLIPSSVGTIFMLSSPAMAARLESWRFDTNKNRLEINTSSP
FT                   VQPQAQLIFNPTRLVIDLPGTTFGRPQLTQQVGGAIRALRIGQFDEQTTRLVVELVPRY
FT                   TLDPNLVKFTANTGSRWLVELPQIIAQALRSSGNVGEQATETPAFIPPQSPFTPAATTS
FT                   NTYNMVTTSPVTLPNQEVAISPTGRVTQIENLQVTGDGFFIRISGGKPQIQVNRSPDNR
FT                   TINLEITGAALSSNLRQRDLLINRYGVRRIQFTQVSSRTPTVRITLQVDSNSADWRAIS
FT                   SGNDGFVVLPNRFTRLPDSQPSTQILSNSPATIQAVELAANGTQLLIKANQSVSATGGW
FT                   DRSSGLFRIIIPNAKLASRVQGPAFDANSPVLRVRFQPQVPNNVVVLVQPASGVQIGEL
FT                   NQVGEQILALQLQNSRRLQPPITLSPLPGTRGQLPSIEENPQPPQQPRLSVPRGKLIVV
FT                   IDPGHGGKDSGAPGIGGLLEKDVILPIGRRVAAILERNGVQAVMTRDADFFVELQGRVD
FT                   IAKRVNAILFVSIHANSVDSRPDVNGLEVYYYDSGYDLAEVVRKTILQDISTIKDRGTR
FT                   KARFYVLRKNTMPAILVETGYMTGREDNPRLGSPEYQSRMADAIARGILQYLRQR"
     MKLHWLIPSS VGTIFMLSSP AMAARLESWR FDTNKNRLEI NTSSPVQPQA QLIFNPTRLV        60
     IDLPGTTFGR PQLTQQVGGA IRALRIGQFD EQTTRLVVEL VPRYTLDPNL VKFTANTGSR       120
     WLVELPQIIA QALRSSGNVG EQATETPAFI PPQSPFTPAA TTSNTYNMVT TSPVTLPNQE       180
     VAISPTGRVT QIENLQVTGD GFFIRISGGK PQIQVNRSPD NRTINLEITG AALSSNLRQR       240
     DLLINRYGVR RIQFTQVSSR TPTVRITLQV DSNSADWRAI SSGNDGFVVL PNRFTRLPDS       300
     QPSTQILSNS PATIQAVELA ANGTQLLIKA NQSVSATGGW DRSSGLFRII IPNAKLASRV       360
     QGPAFDANSP VLRVRFQPQV PNNVVVLVQP ASGVQIGELN QVGEQILALQ LQNSRRLQPP       420
     ITLSPLPGTR GQLPSIEENP QPPQQPRLSV PRGKLIVVID PGHGGKDSGA PGIGGLLEKD       480
     VILPIGRRVA AILERNGVQA VMTRDADFFV ELQGRVDIAK RVNAILFVSI HANSVDSRPD       540
     VNGLEVYYYD SGYDLAEVVR KTILQDISTI KDRGTRKARF YVLRKNTMPA ILVETGYMTG       600
     REDNPRLGSP EYQSRMADAI ARGILQYLRQ R                                      631
//

If you have problems or comments...

PBIL Back to PBIL home page