(data stored in SCRATCH zone)

EMBL: CP002059.PE61

CP002059.PE61        Location/Qualifiers
FT   CDS             complement(65947..67467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0076"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   npu:Npun_F6129 secretion protein HlyD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62729"
FT                   /db_xref="GOA:D7DVC1"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVC1"
FT                   /inference="protein motif:PFAM:PF00529"
FT                   /protein_id="ADI62729.1"
FT                   /translation="MDYLRRYENNVWNGSHDPNSEHLHLVEVNEFLPQIHKWTSIGVGV
FT                   MLTIFVVGVGLTTVLNYKVTVKVPASIRPMGELRLVESAISGQVQKIVVKDNQIVTQGD
FT                   AITYVDDSRLQTQKSQLQSNIQQGQLQIVHIDAQLGEINTQISAQANLNNRTILAAQAE
FT                   LGGTQRNFDDQQIKANAEMSQAEVALRFTKSQLERLQQDRVLTTTIDEAQTALNLAKLQ
FT                   RDRLQVIANSGAISHSMLEEKQQAVKSAQAKLEQAKNNAETLLEEKQQALEIARTNLYK
FT                   ARTAINPSNSAVIIASERIKQEEARSEATLAALKKELQTLLQQRLEIQKQLIRGRQDLL
FT                   QTQTDLNQSVIRAPITGTLLQLRLRNPGQVVQPSEAIAQIAPLNAPLQIKAYVPAQEIN
FT                   KVEAGQKVQMQVSACPYPDYGTLKGIVKNVAPDIFPVAQTQSQNNTAANIQQVNGYEVT
FT                   IEPETLYVGRGDRQCHLQPGMQGRTDIISREETVVQFILRKARLITDL"
     MDYLRRYENN VWNGSHDPNS EHLHLVEVNE FLPQIHKWTS IGVGVMLTIF VVGVGLTTVL        60
     NYKVTVKVPA SIRPMGELRL VESAISGQVQ KIVVKDNQIV TQGDAITYVD DSRLQTQKSQ       120
     LQSNIQQGQL QIVHIDAQLG EINTQISAQA NLNNRTILAA QAELGGTQRN FDDQQIKANA       180
     EMSQAEVALR FTKSQLERLQ QDRVLTTTID EAQTALNLAK LQRDRLQVIA NSGAISHSML       240
     EEKQQAVKSA QAKLEQAKNN AETLLEEKQQ ALEIARTNLY KARTAINPSN SAVIIASERI       300
     KQEEARSEAT LAALKKELQT LLQQRLEIQK QLIRGRQDLL QTQTDLNQSV IRAPITGTLL       360
     QLRLRNPGQV VQPSEAIAQI APLNAPLQIK AYVPAQEINK VEAGQKVQMQ VSACPYPDYG       420
     TLKGIVKNVA PDIFPVAQTQ SQNNTAANIQ QVNGYEVTIE PETLYVGRGD RQCHLQPGMQ       480
     GRTDIISREE TVVQFILRKA RLITDL                                            506
//

If you have problems or comments...

PBIL Back to PBIL home page