(data stored in SCRATCH zone)

EMBL: CP002059.PE71

CP002059.PE71        Location/Qualifiers
FT   CDS             77663..78481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0089"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:all3713 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62739"
FT                   /db_xref="GOA:D7DVE3"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVE3"
FT                   /inference="similar to AA sequence:KEGG:all3713"
FT                   /protein_id="ADI62739.1"
FT                   /translation="MLNILFLAQSSTSRTQKTIKTVPASESPITYLLMFSSGGLLLALI
FT                   AGILYGKILVRNYDKKVKFEKFRTRELEKKLKLALETIRKMETNPDLVHSRDFNLDYLR
FT                   MRMSEEVFHFGVVNQIKLKIKDKISLALRPGQSQQGQVGIASNAGRQLDEIFDVEYETG
FT                   VSPNIVKRVLFRVQIRLMKLPTQATSATISQIIDCIETYLSPREDDDSWQPTIQGRIVY
FT                   MHWDQKAKPTPLLVLEQSNEGVNVTFRTTRQPNATIPPNPPIQKNKAQGS"
     MLNILFLAQS STSRTQKTIK TVPASESPIT YLLMFSSGGL LLALIAGILY GKILVRNYDK        60
     KVKFEKFRTR ELEKKLKLAL ETIRKMETNP DLVHSRDFNL DYLRMRMSEE VFHFGVVNQI       120
     KLKIKDKISL ALRPGQSQQG QVGIASNAGR QLDEIFDVEY ETGVSPNIVK RVLFRVQIRL       180
     MKLPTQATSA TISQIIDCIE TYLSPREDDD SWQPTIQGRI VYMHWDQKAK PTPLLVLEQS       240
     NEGVNVTFRT TRQPNATIPP NPPIQKNKAQ GS                                     272
//

If you have problems or comments...

PBIL Back to PBIL home page