(data stored in SCRATCH zone)

EMBL: CP002059.PE73

CP002059.PE73        Location/Qualifiers
FT   CDS             complement(79339..80493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0091"
FT                   /product="DevC protein"
FT                   /note="KEGG: npu:Npun_R5575 DevC protein; TIGRFAM: DevC
FT                   protein; PFAM: protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62741"
FT                   /db_xref="GOA:D7DVJ4"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR005891"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVJ4"
FT                   /inference="protein motif:TFAM:TIGR01185"
FT                   /protein_id="ADI62741.1"
FT                   /translation="MTQKIPLSWLQLTREKTRLAVALSGIAFADILMFMQLGFRDALYY
FT                   SNVRMHGSLKGDIVLINTQSNAVLAMKPFSQRRLYKALDLPAVESVYPIYLDYTSWKNP
FT                   ITGRPRSILTFGINPELNVFDLPGVEENLDKLKLPDVVLFDRSSRLEYGPIAADFDQGK
FT                   NVTAEVRRRKIKVTGLFTLGASFGADGNLITSDVNFLRLFTTRQRGLIDIGLIKLKPGA
FT                   DPNQVAAYLRTYLPTDVNILTKREFIDYERNYWASSTAIGFIFTLGTIMGFIVGTVIVY
FT                   QILYTEVTEHLSEYATLKAIGYTQNYLLTVILQEAFMLAVLGYLPGFACALFMYHVARD
FT                   ATLLPVFMSHERAIMVLILTIFMCFISGIIAMRKLRSADPADIF"
     MTQKIPLSWL QLTREKTRLA VALSGIAFAD ILMFMQLGFR DALYYSNVRM HGSLKGDIVL        60
     INTQSNAVLA MKPFSQRRLY KALDLPAVES VYPIYLDYTS WKNPITGRPR SILTFGINPE       120
     LNVFDLPGVE ENLDKLKLPD VVLFDRSSRL EYGPIAADFD QGKNVTAEVR RRKIKVTGLF       180
     TLGASFGADG NLITSDVNFL RLFTTRQRGL IDIGLIKLKP GADPNQVAAY LRTYLPTDVN       240
     ILTKREFIDY ERNYWASSTA IGFIFTLGTI MGFIVGTVIV YQILYTEVTE HLSEYATLKA       300
     IGYTQNYLLT VILQEAFMLA VLGYLPGFAC ALFMYHVARD ATLLPVFMSH ERAIMVLILT       360
     IFMCFISGII AMRKLRSADP ADIF                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page