(data stored in SCRATCH zone)

EMBL: CP002059.PE95

CP002059.PE95        Location/Qualifiers
FT   CDS             103663..105075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0117"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="KEGG: npu:Npun_R6150 phospholipid/glycerol
FT                   acyltransferase; PFAM: phospholipid/glycerol
FT                   acyltransferase; SMART: phospholipid/glycerol
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62763"
FT                   /db_xref="GOA:D7DVL6"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVL6"
FT                   /inference="protein motif:PFAM:PF01553"
FT                   /protein_id="ADI62763.1"
FT                   /translation="MPKLIHSTQPPLKFISPRFNPLVLKTVSWFLPLILWVRTRPWLPA
FT                   GIVKIEAKNAEILAKLYQEFQAGKIRFLIAFRHPEVEDPLSMLYLLSRIVPKVARDKGI
FT                   PLEYPVHSHFMYERGMTLWAGNWLGWLFSYVGGVPVRRGRRVDRNAIQMARDLFANAKM
FT                   PIAIAPEGGINGHSGIVSPLEPGVAQLGFWCVEDLQKANREETVVIIPIGIKYSYVNPP
FT                   WSKIDWLLSKLEADSGLPVAEINPTGKKLEEVLCQRILNLAEYLITEMEEFYRCFYHRD
FT                   LPAILAKETAKPNDILITRLHRLMDTALQVCEQYFNVQPQGNFIYRCRRLEEAGWNYIY
FT                   RDKIADINSLPPFKRALADWVAEEADLRMQHMRIAEGFVAVTANYIQDKPTAERFAETA
FT                   LLMFDMLSRIKESTLPGRPRLGLKQAMITVGKPISVSERWQMCQGNKQASRRELSDLTN
FT                   DLQVELEALVKD"
     MPKLIHSTQP PLKFISPRFN PLVLKTVSWF LPLILWVRTR PWLPAGIVKI EAKNAEILAK        60
     LYQEFQAGKI RFLIAFRHPE VEDPLSMLYL LSRIVPKVAR DKGIPLEYPV HSHFMYERGM       120
     TLWAGNWLGW LFSYVGGVPV RRGRRVDRNA IQMARDLFAN AKMPIAIAPE GGINGHSGIV       180
     SPLEPGVAQL GFWCVEDLQK ANREETVVII PIGIKYSYVN PPWSKIDWLL SKLEADSGLP       240
     VAEINPTGKK LEEVLCQRIL NLAEYLITEM EEFYRCFYHR DLPAILAKET AKPNDILITR       300
     LHRLMDTALQ VCEQYFNVQP QGNFIYRCRR LEEAGWNYIY RDKIADINSL PPFKRALADW       360
     VAEEADLRMQ HMRIAEGFVA VTANYIQDKP TAERFAETAL LMFDMLSRIK ESTLPGRPRL       420
     GLKQAMITVG KPISVSERWQ MCQGNKQASR RELSDLTNDL QVELEALVKD                  470
//

If you have problems or comments...

PBIL Back to PBIL home page