(data stored in SCRATCH zone)

EMBL: CP002105.PE109

CP002105.PE109       Location/Qualifiers
FT   CDS             119543..120094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0110"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="COGs: COG0634 Hypoxanthine-guanine
FT                   phosphoribosyltransferase; InterPro IPR000836:IPR005904;
FT                   KEGG: hor:Hore_00570 hypoxanthine
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase;
FT                   PRIAM: Hypoxanthine phosphoribosyltransferase; SPTR: B8D064
FT                   Hypoxanthine phosphoribosyltransferase; TIGRFAM:
FT                   hypoxanthine phosphoribosyltransferase; PFAM:
FT                   Phosphoribosyl transferase domain; TIGRFAM: hypoxanthine
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11661"
FT                   /db_xref="GOA:D9QSX3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D9QSX3"
FT                   /protein_id="ADL11661.1"
FT                   /translation="MRDKLADKIDEILVTEDELQERIAEMGAEITADYNRDDDVVMVGV
FT                   LRGGIIFMADLARHVKLPVTFDFMDVSSYDGTESSGVVRIIKDLEENIEDRHVLIVEDI
FT                   IDTGRTLKHVVDFLETRDPASIKICTLLDKPERRTVKKVEVDYNGFEIPDEFAVGYGLD
FT                   YDERYRNVPFIFVLKPKFYD"
     MRDKLADKID EILVTEDELQ ERIAEMGAEI TADYNRDDDV VMVGVLRGGI IFMADLARHV        60
     KLPVTFDFMD VSSYDGTESS GVVRIIKDLE ENIEDRHVLI VEDIIDTGRT LKHVVDFLET       120
     RDPASIKICT LLDKPERRTV KKVEVDYNGF EIPDEFAVGY GLDYDERYRN VPFIFVLKPK       180
     FYD                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page