(data stored in SCRATCH zone)

EMBL: CP002105.PE124

CP002105.PE124       Location/Qualifiers
FT   CDS             135490..136752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0125"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG1306 conserved hypothetical protein; KEGG:
FT                   hor:Hore_00830 hypothetical protein; SPTR: B8D090
FT                   Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11676"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025275"
FT                   /db_xref="UniProtKB/TrEMBL:D9QSY8"
FT                   /protein_id="ADL11676.1"
FT                   /translation="MKKEFIVVVIFVLLFSVGITARSLDYNSSVNDVNLHKKNNGEEQL
FT                   KDSQELKQETSEPIKGIYLTGWVAGSPKRFNRLLNLITETELNAMVIDVKNIEGEVSYN
FT                   SKVDLTEEIGANVAKIKNIDRLLDKCKENNIYSIARIPVFKDYKLAAYKEYALKYYDLQ
FT                   QSNSEIFSSPEWVNPYSKKVWKYNVDLAIEAVKHGFDEVQFDYIRFPVFFNRSRYNLAV
FT                   APSNSKVRIIDDFLRYAKNRLDKLEAPVSIDVFGLTTTGNDLGIGQNFALMAQRIDYIS
FT                   PMVYPSHYQPGIYGLTLPEQTPYSTVFNSMQEAKEKLNGETGQIRPWLQDFSLRYKYGV
FT                   EEVREQIAAAKASGLDSWLLWNPASNYTWQAFLDNEIVINKKKRLIDIIDDIEGDNDVR
FT                   VNRRESNAQENESRERPFDRT"
     MKKEFIVVVI FVLLFSVGIT ARSLDYNSSV NDVNLHKKNN GEEQLKDSQE LKQETSEPIK        60
     GIYLTGWVAG SPKRFNRLLN LITETELNAM VIDVKNIEGE VSYNSKVDLT EEIGANVAKI       120
     KNIDRLLDKC KENNIYSIAR IPVFKDYKLA AYKEYALKYY DLQQSNSEIF SSPEWVNPYS       180
     KKVWKYNVDL AIEAVKHGFD EVQFDYIRFP VFFNRSRYNL AVAPSNSKVR IIDDFLRYAK       240
     NRLDKLEAPV SIDVFGLTTT GNDLGIGQNF ALMAQRIDYI SPMVYPSHYQ PGIYGLTLPE       300
     QTPYSTVFNS MQEAKEKLNG ETGQIRPWLQ DFSLRYKYGV EEVREQIAAA KASGLDSWLL       360
     WNPASNYTWQ AFLDNEIVIN KKKRLIDIID DIEGDNDVRV NRRESNAQEN ESRERPFDRT       420
//

If you have problems or comments...

PBIL Back to PBIL home page